KEGG   Mannheimia succiniciproducens: MS0712Help
Entry
MS0712            CDS       T00201                                 

Gene name
ruvA
Definition
(GenBank) RuvA protein
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
msu  Mannheimia succiniciproducens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:msu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MS0712 (ruvA)
Enzymes [BR:msu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MS0712 (ruvA)
DNA repair and recombination proteins [BR:msu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MS0712 (ruvA)
    RecFOR pathway proteins
     MS0712 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
662389..663036
Genome map
AA seq 215 aa AA seqDB search
MANFIVNVKVCMIGRLQGILLEKQPPEILLDVHGIGYELLLPMTSFYNLPEIGQETVLFT
HLVVREDAHLLFGFSAKTDRTLFRELIKTNGVGPKLALAILSAMSVNEFAYAIEHEELSK
LVKIPGVGKKTAERLLVELKGKFKGIKQPDFFVESSHVGAVDPVTTSPEVPAEEAVAALM
ALGYKASDAEKMVKRIAKPHLTSEQLIREALKAAL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtggccaattttattgttaacgttaaggtatgtatgataggtcgactccagggcatttta
cttgaaaaacaaccgcctgaaattttgttagatgttcatggtatcggttatgaattattg
ctgccgatgacaagtttttataatttacctgaaatcgggcaagagacggttttatttact
catcttgtggtgcgcgaagacgctcatcttctgtttggattttccgccaaaaccgaccgc
actttattccgtgaactcatcaaaaccaatggtgtcgggccaaaactggcgctggctatt
ttgtctgcgatgtcagtaaatgaatttgcttatgctatcgagcatgaggaattatccaaa
ttagtgaaaattccgggcgtaggtaaaaaaacggcggaacgcttgcttgttgaactgaaa
ggtaagtttaaaggcattaaacagccggacttctttgttgaaagtagccatgtcggtgcg
gtagatcccgttacaacttctcccgaagtacctgccgaagaggcggttgccgccttaatg
gcgttgggatataaagcgagcgatgcggaaaaaatggtaaaacgaatagcgaaacctcat
ttaaccagcgaacaacttatccgtgaagccttaaaagccgcattatag

DBGET integrated database retrieval system