KEGG   Mannheimia succiniciproducens: MS0712Help
Entry
MS0712            CDS       T00201                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
msu  Mannheimia succiniciproducens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:msu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MS0712 (ruvA)
Enzymes [BR:msu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MS0712 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
662422..663036
Genome map
AA seq 204 aa AA seqDB search
MIGRLQGILLEKQPPEILLDVHGIGYELLLPMTSFYNLPEIGQETVLFTHLVVREDAHLL
FGFSAKTDRTLFRELIKTNGVGPKLALAILSAMSVNEFAYAIEHEELSKLVKIPGVGKKT
AERLLVELKGKFKGIKQPDFFVESSHVGAVDPVTTSPEVPAEEAVAALMALGYKASDAEK
MVKRIAKPHLTSEQLIREALKAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgataggtcgactccagggcattttacttgaaaaacaaccgcctgaaattttgttagat
gttcatggtatcggttatgaattattgctgccgatgacaagtttttataatttacctgaa
atcgggcaagagacggttttatttactcatcttgtggtgcgcgaagacgctcatcttctg
tttggattttccgccaaaaccgaccgcactttattccgtgaactcatcaaaaccaatggt
gtcgggccaaaactggcgctggctattttgtctgcgatgtcagtaaatgaatttgcttat
gctatcgagcatgaggaattatccaaattagtgaaaattccgggcgtaggtaaaaaaacg
gcggaacgcttgcttgttgaactgaaaggtaagtttaaaggcattaaacagccggacttc
tttgttgaaagtagccatgtcggtgcggtagatcccgttacaacttctcccgaagtacct
gccgaagaggcggttgccgccttaatggcgttgggatataaagcgagcgatgcggaaaaa
atggtaaaacgaatagcgaaacctcatttaaccagcgaacaacttatccgtgaagcctta
aaagccgcattatag

DBGET integrated database retrieval system