KEGG   Mannheimia succiniciproducens: MS0712Help
Entry
MS0712            CDS       T00201                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
msu  Mannheimia succiniciproducens
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:msu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
662422..663036
Genome map
AA seq 204 aa AA seqDB search
MIGRLQGILLEKQPPEILLDVHGIGYELLLPMTSFYNLPEIGQETVLFTHLVVREDAHLL
FGFSAKTDRTLFRELIKTNGVGPKLALAILSAMSVNEFAYAIEHEELSKLVKIPGVGKKT
AERLLVELKGKFKGIKQPDFFVESSHVGAVDPVTTSPEVPAEEAVAALMALGYKASDAEK
MVKRIAKPHLTSEQLIREALKAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgataggtcgactccagggcattttacttgaaaaacaaccgcctgaaattttgttagat
gttcatggtatcggttatgaattattgctgccgatgacaagtttttataatttacctgaa
atcgggcaagagacggttttatttactcatcttgtggtgcgcgaagacgctcatcttctg
tttggattttccgccaaaaccgaccgcactttattccgtgaactcatcaaaaccaatggt
gtcgggccaaaactggcgctggctattttgtctgcgatgtcagtaaatgaatttgcttat
gctatcgagcatgaggaattatccaaattagtgaaaattccgggcgtaggtaaaaaaacg
gcggaacgcttgcttgttgaactgaaaggtaagtttaaaggcattaaacagccggacttc
tttgttgaaagtagccatgtcggtgcggtagatcccgttacaacttctcccgaagtacct
gccgaagaggcggttgccgccttaatggcgttgggatataaagcgagcgatgcggaaaaa
atggtaaaacgaatagcgaaacctcatttaaccagcgaacaacttatccgtgaagcctta
aaagccgcattatag

DBGET integrated database retrieval system