KEGG   Mannheimia succiniciproducens: MS0749Help
Entry
MS0749            CDS       T00201                                 

Gene name
lacZ
Definition
LacZ protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
msu  Mannheimia succiniciproducens
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:msu00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:msu00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:msu00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
719014..722055
Genome map
AA seq 1013 aa AA seqDB search
MFLPNYFQNPQILHVNATPHHAYFIPHDSVESAVKNPRESSAFFTLLNGEWNFQYFASYY
DLTEDFLTRHLPDKIPVPANWQNHGYDHHQYTNVNYPIPFDPPYVPQDNPCGLYQRKFCI
NLNKAKRYLLNFEGVDSCLFVYINQQFVGYSQISHCTSEFDVTDFLRQGENEIHVLVLKW
CDGSYLEDQDKFRMSGIFRDVYLLERESHYLQDFFIRTELAEDLKSAVLKVEPFFVQAGE
PAALREMAWQLSDPQGNILLSAVTERGFEYVVNELQLWNAEQPKLYTLLFRYGSEVICQK
IGFRKIEVKEGVLHFNHQPIKFKGVNRHDSDPKTGYVISREQALTDLRLIKTHNFNAIRT
AHYPNAPWFAELCDELGFYLIAESDIESHGSNAVYVEMPETSILLNVKTDPKTDEIQQKT
VDEYCYFARDPNFKQAILDRTYANVQRDKNRASVVIWSLGNESGFGENFEAAAKWVKGFD
PSRLVHYENSIYQHSEHTNDLTHIDLYSEMYASTESMQAHFADPNNRKPYLLCEYSHAMG
NSCGDAEDYWQIFNQYPQACGGFVWEWCNHSPYLTDGKMGYGGDFGDEPNDGNFCADGLV
TADRQVQSSLLEMKNVNRPLRANLTAQGVELTNYLDFTDTEDFIAVHYQFSENGIVVGEG
YIDDVKISPKQTALLPLNLPEDNGNLWLLDLTYYQKKETPLVAKNHQLGFDQIALFGQRI
VPVARIGRVKSAVKIWQDSAVIKIQTEKAQFVMDKRKGIVQQIMTEQGGLLREPLDFNIW
RALADNDNLIKRQWQAAGYDRAITRAYEIQAEDFSYKAVVKAKCGLVALSKARILTLDVV
YHIYANGELKIEIDAEKAPQLPFLPRFGFRFVLDEAFQQGEYFGYGETESYADKHHGAKL
GLYRTTAQQNHRDYLKPQENGSHWGCSFVKLRSENEEICVTSDKPFSFNLSPYKQESLQK
AKHNYDLEDSNSTVLCIDYKMSGIGSNSCGPVLKAIYRLKENKWHCGFRLQIL
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgtttttacctaattatttccaaaatccgcaaattcttcatgttaacgccacgcctcat
cacgcttattttattcctcatgattcggtggaaagtgcggtcaaaaatccgcgagaatct
tccgctttttttaccttgctgaacggcgaatggaattttcagtattttgcaagttattat
gatttaacggaggattttttaacccggcatttgcccgataaaattccggtgccggcaaat
tggcaaaatcacggctatgatcatcatcaatataccaatgtgaattacccgattcctttt
gatccgccttatgtgccgcaggataatccttgcgggctttatcagcgcaaattttgtatt
aatttgaataaggctaaacgctatttattgaattttgaaggtgtggatagttgcttattt
gtctatattaatcaacagtttgtcggttacagtcaaatcagccactgcacctcggaattt
gatgtcacggattttttacgccaaggtgaaaacgaaattcatgtgcttgtattgaaatgg
tgcgacggttcttatttggaagatcaggataaattccgtatgtcgggtattttccgcgat
gtgtatttattagaacgtgaaagccattatttgcaggatttctttattcgtaccgaattg
gcggaagatctgaaaagtgcggtattaaaagtggaaccttttttcgtgcaggcgggggaa
cccgcagcgttgcgggaaatggcatggcagttgagtgatccgcagggcaatattctgcta
agtgcggtgacggagcgcggttttgagtatgtcgtaaacgaactgcagctttggaatgcc
gagcaaccgaaactttataccttactgtttcggtacggctcggaagttatttgccagaaa
atcggtttccggaaaatcgaggtaaaagaaggcgtgttgcatttcaatcatcagccgatt
aagtttaaaggcgtgaatcgccatgacagcgacccaaaaaccggttatgtcattagccgg
gaacaggcgttgacggatttacgtttaatcaaaacccataattttaatgcaatccgtacc
gcacattatcctaacgcgccttggtttgcggaattatgcgatgaattaggtttttatttg
attgcggaaagcgatatagaaagccacggcagcaatgcggtttatgtagaaatgccggaa
acgagtattttgctgaatgtaaaaactgatccgaaaacggatgaaattcagcaaaaaact
gtggatgaatattgctatttcgcgcgcgatccgaattttaaacaagcgattctggatcgt
acttacgccaatgttcagcgtgataaaaaccgcgccagcgtagtgatttggtcattgggt
aacgaaagcggtttcggtgagaatttcgaagcggcggcaaaatgggttaaggggtttgat
ccgagccgtttggtacattatgaaaattctatttatcagcattccgagcatacaaacgat
ttaactcacattgatttatacagcgaaatgtacgcaagcacggaatccatgcaggcgcat
tttgccgatccgaataatcgcaaaccttatttgctgtgcgaatatagccatgctatgggt
aattcctgcggcgatgcggaagattattggcaaatctttaatcaatatccgcaggcttgc
ggcggttttgtgtgggaatggtgcaatcattcgccttatttaaccgatgggaaaatgggg
tacggcggtgatttcggcgatgagcccaatgacggcaatttctgtgccgacggtttggtc
actgcggatcggcaggtgcaaagcagtttgctggaaatgaagaacgttaatcgtccgttg
cgggcaaatttaacggcgcaaggagtggaattaaccaactatctggactttaccgatacg
gaagattttatcgccgtgcattatcaattcagcgaaaacggcattgttgtcggcgaaggt
tatattgatgacgtgaaaatttcgccaaaacagaccgcacttttgccgttaaatttgcct
gaagacaacggtaatttatggttgctggatttaacttattatcaaaaaaaggaaacgccg
cttgtggcaaaaaatcaccaacttggatttgatcaaattgcgctgttcgggcaacggatc
gtgccggtggcaagaatcggccgggtaaaaagtgcggtcaaaatctggcaagattctgcg
gtgatcaagattcagacggaaaaagcgcaatttgtgatggataaacgcaagggtatcgtg
caacagattatgacggaacagggcggattattgcgtgagccgctggatttcaatatttgg
cgggcgttagcggacaatgataatctgatcaaacggcaatggcaggcggcgggttatgat
cgcgcaataacacgggcttacgagattcaggcggaggatttttcctacaaggcggtggtt
aaagcgaaatgcgggctggttgcgttgtcgaaagcgcggattttaacccttgatgtggta
taccatatttatgccaacggcgaactgaaaattgaaatcgatgcggaaaaagcgccacag
ttgccgtttttgcctcgtttcggttttcgttttgtgttggatgaggctttccaacagggt
gaatattttggttatggcgaaacggaaagttatgcggataaacatcatggagcaaaattg
ggattgtatcgcactacggcgcaacaaaatcatcgggattatctcaaaccgcaggaaaac
ggcagccattggggttgttcttttgtcaaactgcggtcggaaaacgaggaaatttgtgta
acttccgacaagccgtttagttttaatctttcgccttataagcaagagagcctgcaaaag
gcgaaacataattatgatttggaagactcaaactcaacggtgctttgcattgattacaaa
atgagcggaataggctcgaattcctgcggaccggttttgaaagcaatataccgtttgaaa
gaaaacaaatggcattgcggcttcagattgcagattttataa

DBGET integrated database retrieval system