KEGG   Mannheimia succiniciproducens: MS0806Help
Entry
MS0806            CDS       T00201                                 

Gene name
lacZ
Definition
LacZ protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
msu  Mannheimia succiniciproducens
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MS0806 (lacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    MS0806 (lacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MS0806 (lacZ)
Enzymes [BR:msu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     MS0806 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(777836..780862)
Genome map
AA seq 1008 aa AA seqDB search
MFIHRYFEDPQALHINTTPHHAYFIPQKCGQKWENFEPEQSLFYLSLNGYWDFRYYLSPQ
ELPESPNEVNFEAKIPVPSNWQTQGYDRHHYTNINYPFPFDPPYVPQNNPCGIYRRTFEL
NKKENKHYLLNFEGVDSCLYVYINQTFVGYGQISHSTNEFDITDFVQAGNNEIFVVVLKW
CDGSYLEDQDKFRMSGIFRDVYILEREANYLQDFFIRTDLSPNLNNAQIKVETKFLENNQ
NIDYALYDPSGKLLIQQQTDKFEISFDNPETWNAENPRLYTLIMSYGQEQIVQRLGFRRI
QIENGILLFNGQPIKFRGVNRHDSDPVTGYHISRTQAVRDLQLMKAHNINAIRTAHYPNA
PWFSELCDRYGFYLIGESDIESHGSSMLAVRQTEPSIFLNVKNSYEHERIRQDNIDNLCY
FARDPQFKEALLDRTYANVERDKNRTSVIIWSLGNESGYGENFEACAAWVKSRDPGRLVH
YESSIYQHSAHRNDLSNLDFYSEMYAATEDLDAYFANPANLKPFMLCEYSHAMGNSNGDA
EDYFQAFHRHPGSCGGFVWEWCDHAPYRDDKPEHFGYGGDFGESPHDGNFCVDGLVSPDR
IPHTNLLELKNVNRPVRAWLEQGKVYIKNYLDFTNLKEILTIRYSFSENGKVINQSELQI
DCAPHQIQVLDIALPADNGNLCWLNLDYVLTQPTDLLSKNHLLGFDQLIIFKQGALPAQI
FKNKTGHFKIQDTAQTLKICQGDFSYELDKNKGIFSRITYREQNLIEQPLDFNIWRAPLD
NDRLIRQSWQQAGYDKTYSRAYQINWIEKNEGILIQANLALLAVSQGRILNLAVNYLLGA
DGQMKISLRATRPEHLPYLPRFGLRFFLPKGQTQGQYFGYGPQESYVDKHHLAKLGIYPL
NATDNYVDYLKPQENGSHYGSRYITLNSLHVSADQPFSFNLLPYSQEELTTKAHNYELKE
SPWDILCLDYKMSGIGSNSCGPNLKEQYRLSETDFNWGVFLQWSNPAR
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgtttatccatcgttattttgaagaccctcaagccttgcatattaatacgactcctcat
cacgcctattttattccgcaaaagtgcggtcaaaaatgggaaaattttgagcctgagcaa
tcgcttttttatttaagcctgaacggttactgggatttccgctactatctcagccctcaa
gaattgccggaatcgccaaatgaagtgaatttcgaagcaaaaatccctgtaccctcaaat
tggcagacccaaggatatgatcggcaccattatactaacatcaactatcctttccctttt
gatccaccttatgttcctcagaataatccatgcggaatctatcggcggacatttgagttg
aataagaaagaaaataaacattatctgctcaatttcgaaggggtagatagttgcctttat
gtctatattaatcaaactttcgtaggctacgggcaaatcagccactctactaatgaattt
gatattacggattttgtgcaagcgggcaacaatgaaattttcgtagtagttcttaaatgg
tgtgacggttcttatctggaagatcaggataaattccgcatgtccggtattttcagagat
gtttatatcttagaacgagaagcaaattaccttcaagacttttttatccgcaccgacctt
tctccgaatcttaataatgcgcaaattaaagtggaaactaaattcctggagaataatcag
aatatagattatgccctttatgatccaagcgggaagctgttaattcaacaacaaaccgac
aaatttgaaatctcttttgataatccggaaacctggaatgccgaaaatcctcgcctttat
actcttataatgtcttatggacaagaacaaattgttcagcgattaggcttccgccgtatt
caaatagaaaacggcattcttttatttaacggacaacctattaaattccgcggagttaat
cgtcatgacagcgatcccgtcaccggctatcatatcagccgcactcaggctgtccgagat
ctgcaactgatgaaagcccataatattaacgctatccgaacagcccactatcctaatgcc
ccctggtttagtgaactttgtgatcggtacggtttctatttaatcggcgaaagcgatatt
gaaagtcacggttcttccatgctggcagttagacagaccgaaccaagtatctttcttaac
gttaagaatagctatgaacatgaacgcattcgacaggataatattgataatctttgctat
tttgctcgagatccgcaattcaaagaagctttgttggacagaacttatgcaaatgtcgaa
cgggataaaaaccgaacctcggttataatctggtcgctgggtaacgaaagcggttacgga
gaaaactttgaggcttgtgccgcctgggttaaatcacgtgatcccggccgtttggttcat
tatgaaagctctatctaccagcattccgcccatcggaatgacttatccaatcttgatttc
tacagcgaaatgtatgctgcaacagaagatctggatgcctatttcgccaatccggcaaac
cttaaacccttcatgctctgcgaatacagccacgctatgggtaattctaatggagatgct
gaagactactttcaagctttccaccgtcatccgggatcctgcggcggctttgtctgggaa
tggtgtgatcacgccccttatagagatgataaaccggaacatttcggttatggcggcgat
tttggcgaaagccctcacgacggcaatttctgcgtggacggattggtctcgcccgatcga
attccccataccaacttattggaattaaaaaatgtcaatcgtccggttcgtgcttggtta
gaacaaggaaaagtttatattaaaaattacctggattttaccaatctcaaggaaattctg
accattcgttacagttttagtgaaaacggaaaagtgattaatcaaagcgaattacagatt
gattgcgcccctcatcagatccaagtattggatatagccctacctgccgataacggcaat
ctctgttggctgaatttggactatgttttaactcaaccgacggatctgctaagcaaaaac
catctcctaggtttcgatcaattaattattttcaaacaaggtgccctacccgctcaaatc
tttaaaaataaaaccggacattttaaaattcaggataccgctcaaacattgaagatttgc
caaggcgattttagctatgaactggataagaataagggaattttctcccgaattacttat
cgggaacaaaatcttatcgaacaacctctggattttaatatctggcgagcgcctcttgat
aatgatcgactgatccgccaaagctggcaacaagcaggctatgataaaacctatagcaga
gcttaccaaatcaactggatagagaaaaacgaaggaatactgattcaagcgaatttagct
ctgctggcagtgtctcaggggcggattctgaacttagcggtaaactatctgctaggcgcc
gatggtcaaatgaaaatcagcctccgggcaacccgtcctgagcacttaccctacctacct
cgcttcggtcttcgtttctttctacctaaaggtcaaacccaaggacaatattttggctat
ggcccgcaggaaagttatgtggataaacatcatctggcaaaactggggatttatcctctc
aatgcaacggacaactatgtggattatctcaaacctcaggaaaacggcagtcactacggt
agccggtacataaccctgaacagtctgcatgtcagcgccgatcagcctttcagttttaat
ttattgccttatagtcaggaagaactgaccaccaaagcccataattatgagctgaaagaa
tcgccttgggatattctatgccttgattataaaatgagtggaatcggttccaattcctgc
ggtccgaacctcaaagagcaataccggcttagcgaaaccgattttaactggggagtcttt
ctgcaatggagcaacccggctcgttag

DBGET integrated database retrieval system