KEGG   Mannheimia succiniciproducens: MS0966Help
Entry
MS0966            CDS       T00201                                 

Gene name
folP
Definition
FolP protein
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
msu  Mannheimia succiniciproducens
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:msu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
941315..942142
Genome map
AA seq 275 aa AA seqDB search
MKLYANNKVLDLSMPKVMGILNFTPDSFSDSGRFFQLDKALAQVEKMVKAGASIIDIGGE
STRPMAEEVTLEQELERVVPLVEAVRQRFDCWISVDTSKAQVMCESAKVGMDIINDIRAL
QEPDALETAVKSGLPVCLMHMQGQPRTMQTNPHYDNVVSEVLEFLQNRTALCLQAGMNPQ
NIIWDMGFGFGKTVQHNYKLLQQLSVFAAQGYPVLAGLSRKSMIGAVLDKTVEQRVTGSV
TAALIAAMNGATILRVHDVEETMDALKIWQATLQA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttatgcgaacaataaagtattagatttgtctatgcctaaggtaatgggaatt
cttaattttacgccggattcgttttcggatagcggtcggttttttcaattggataaagcc
cttgcgcaggttgagaaaatggtgaaagccggtgcttccattattgatatcggtggtgag
tccacgcgtccgatggcggaagaagttacattagagcaagaacttgagcgcgtggttccg
ctggtggaagccgttcgtcaacgtttcgattgctggatttccgtggatacctcaaaagcg
caggtaatgtgcgaaagtgcgaaagtcggtatggatattattaatgatatccgcgccctg
caagagcctgatgcgctggaaacggcggttaaatcaggattgccggtttgtcttatgcat
atgcaggggcaaccgagaacaatgcaaacgaatccgcattatgacaatgtggtgtcggag
gtgttggaatttttgcaaaatcgtaccgcactttgcttacaggcgggaatgaatccgcaa
aatatcatttgggatatggggttcggtttcggtaaaaccgttcagcataattataagctg
ttgcaacagctatccgtttttgcagcacaagggtaccccgttttagctggattatcgcga
aaatccatgattggtgcggtgttggataaaacagtggaacagagagtaaccggtagcgtt
acagcggcgcttattgcggcaatgaacggcgcaacgattttacgcgtacatgatgttgag
gaaacaatggatgcgctcaaaatctggcaagcaactttacaggcttaa

DBGET integrated database retrieval system