KEGG   Mannheimia succiniciproducens: MS1027Help
Entry
MS1027            CDS       T00201                                 

Definition
hypothetical protein
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
msu  Mannheimia succiniciproducens
Brite
Enzymes [BR:msu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     MS1027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1007931..1010921
Genome map
AA seq 996 aa AA seqDB search
MCARRVGILAHQKIITIVNGGQECPPYRKIMSGFNYEKNLPHQEQGIQAVLGVFDHASRR
FHQPDENPQIVFGQNQYTANLQKVQNENGIDRTLSLNSDGINVLDISMETGTGKTYTYTK
TMFDLHRMLGVFKFIVVVPTLSIKAGTQQFLQSQSLAEHFEQDFGSDYQGVRLKTYVVES
QKATKGKKTHIQTAIDAFVKAENRQEIHVLLINAGMINSPSMSNAGDVALKDLFDNPVEA
IAAVRPFVIVDEPHKFPTRESAKTWKNIKQLNPQYILRYGATFNEQYYNLIYRLTAVDAF
NDGLVKGVRVFQEEMQGGMEASIKLLSLDGKEAVFELTENGKSKKFALSKGDDLAQIHSA
IFELKIDALNKTTLVLSNGLELKRGALLNPYSYAQTMQDAMMQRAIAEHFKLERELLVER
TTKIKPLTLFFIDDIKGYRSGNEISGSLKEKFESWVKAEAERRLKNETNEFYRAYLQQTL
ADLSLVHGGYFSKDNSESDDKIEQEINEILHDKQALLSLDNPRRFIFSKWTLREGWDNPN
VFQICKLRSSGSQTSKLQEVGRGLRLPVNELMERVREPQYKLNYFVDSSEKDFVAELIGE
VNQHSFSETIPQKFDEALEQKILQKYPEIEPLDLMFELVEKGIIDRKKVFTENGYTRLKV
AYPQAFEQTLKKDKIGKAGEGKDTIKMRVGKYEELKALWELIHHKAILQYKIGSENEFLA
LFTAYLRENLTKFKQAGIRTAINETYINNGIMLNRRKENLENDDFIRFNTMSYREFLSEL
AVSAKIQMNTLHQAFYALRDELNISEFMNQQTINQIRGGFNQFLLNHSFSKFELGYQLVN
NRIHPTKFTDEKGCAKEVNRADLGIFGDTEKRPSENYLFDEIFFDSEIEHQNIADNEIEN
VTVFTKIPKNSIKIPVAGGGTYSPDFAYIVKTKTGETLNFVIEAKGVESSDILRKSEERK
IKHAEKLFTKIAEKVQVKFLTQFEGDMVAELIRRNI
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcgcgcgtagggtgggcattcttgcccaccaaaaaataataaccattgtaaacggt
gggcaggaatgcccaccctacaggaaaattatgtctggttttaattacgaaaaaaatcta
cctcatcaggaacaaggtattcaagcggttttgggcgtgtttgaccatgcttcccgccga
tttcatcagcccgatgaaaatccgcaaattgtgtttgggcaaaatcaatacactgccaat
ctgcaaaaagtacaaaatgaaaacggtattgaccgcactttgagtttgaattcggatggt
atcaatgtgctggatatttcgatggaaaccggcacgggtaaaacctacacctacaccaaa
acgatgtttgatttgcaccgaatgctgggcgtgttcaaatttattgtggtggttcccacg
ctttcgattaaagcgggtacgcaacagtttttgcaaagccaatcgttggcggaacatttt
gaacaggattttggcagcgattatcaaggcgttcgcctgaaaacctatgtagtggaaagc
caaaaagcaactaagggcaagaaaacgcatattcagacggccatcgatgcttttgtgaaa
gcggaaaatcggcaggaaattcacgttttgctaattaacgctgggatgattaactcgcca
tcgatgagcaatgcgggcgatgtcgcattgaaagatctgtttgataaccctgtggaagcc
attgcggcggtgcgtccgtttgtgattgttgatgaaccgcataagttcccgactcgtgaa
agtgccaaaacgtggaagaatatcaaacagttaaatccgcaatatattttgcgctatggt
gcgacctttaatgagcaatattacaacttgatttaccgcttaacggcggtagatgccttt
aatgatggtttggttaaaggcgtacgtgtgtttcaggaagaaatgcagggcggaatggag
gcaagcatcaagctgctttcgttagacggcaaagaagcggtgtttgaactgactgaaaat
ggcaaaagcaaaaaatttgcactcagcaagggtgatgatttggcacaaattcattcggca
atttttgagttaaaaattgatgcgttgaataaaaccacgctggtgttaagcaatggcttg
gagctgaaacgtggtgcattattaaatccctattcttacgctcaaaccatgcaagatgcg
atgatgcaacgtgcgattgcagagcattttaagttggaacgtgaattgttggtagaacgt
actaccaaaatcaaaccgctaacattgttttttattgatgatattaaggggtatcgtagt
ggcaatgaaattagcggcagtctgaaagaaaaatttgaaagctgggtaaaagcggaagca
gaacgccgtctgaaaaacgaaacaaacgaattttatcgcgcctatctgcaacaaacactg
gcggatttgtcattggtgcacggcggttatttttctaaagataacagcgaaagtgatgac
aaaatcgagcaggaaatcaacgagattttgcacgataaacaggcgttgctgtcgctggat
aatccccgccgttttattttctccaaatggacgttgcgagaaggctgggataatccgaat
gtatttcagatttgcaaattgcgctcaagcggtagccaaacgtctaagctgcaagaagtg
ggacgtggtttacgcttgcctgtgaatgagttaatggagcgtgtgcgtgaaccgcaatac
aaactcaattattttgtggacagcagcgaaaaggattttgtggcggagctgattggtgag
gtaaatcaacattcatttagcgaaaccattccgcagaaatttgatgaagcgcttgaacag
aaaattttgcaaaaatatcctgaaattgaaccgcttgatttgatgtttgaattggtagaa
aaaggcattattgaccgcaaaaaggtctttaccgaaaacggttatacccgtttgaaagtt
gcttatccgcaagcctttgagcaaacgctgaaaaaagacaaaatcggtaaagcaggagaa
ggcaaagacaccatcaaaatgcgggtaggcaaatatgaagaactcaaagctttgtgggaa
ttgattcatcataaagcgattctgcaatacaagattggttcggaaaatgaatttttagca
ttatttactgcttatttgcgtgaaaatctcactaaattcaaacaggctgggattcgcacg
gcgataaatgaaacgtatatcaataatggcattatgctgaaccgccgtaaagagaatctt
gaaaatgatgattttatccgttttaacacaatgagttatcgtgaattcctcagcgagctt
gccgtgagtgccaaaattcagatgaatacattgcaccaagcgttttatgctttgcgggat
gagctgaatatcagcgagtttatgaatcaacagacgattaaccaaattcgtggtggattt
aatcaattcttgttgaatcattcattcagtaaatttgaattgggctatcagttggtcaat
aaccgcattcatccgactaaatttaccgatgaaaaaggttgtgccaaagaggttaatagg
gcggatttgggcatatttggcgatacggagaaaagaccgtctgaaaattatctatttgat
gaaattttctttgattcggaaattgagcatcagaacattgcggataatgagattgagaat
gtaacggtgtttaccaaaattccgaaaaattcgataaagatccctgttgccggcggtggc
acttattcgcctgattttgcctatattgtgaaaaccaaaacaggagaaacgctgaatttt
gtgattgaagccaaaggcgtagaaagctcggatattttgcgtaaaagtgaagagcggaaa
atcaaacatgcggaaaagctattcacgaaaattgccgaaaaggtacaagtgaagttttta
acgcagtttgaaggggatatggtggcggagttaattaggcggaatatataa

DBGET integrated database retrieval system