KEGG   Mannheimia succiniciproducens: MS1098Help
Entry
MS1098            CDS       T00201                                 

Gene name
recD
Definition
(GenBank) RecD protein
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
msu  Mannheimia succiniciproducens
Pathway
msu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:msu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MS1098 (recD)
Enzymes [BR:msu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MS1098 (recD)
DNA repair and recombination proteins [BR:msu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MS1098 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Helicase_RecD Viral_helicase1 DUF2075 AAA_22 UvrD-helicase UvrD_C PhoH AAA_16 ABC_tran DEAD T2SSE NACHT AAA AAA_5 TrwB_AAD_bind ResIII CbiA
Motif
Other DBs
NCBI-ProteinID: AAU37705
UniProt: Q65TK5
Position
complement(1080342..1082273)
Genome map
AA seq 643 aa AA seqDB search
MLEILAKLQQENVITAGDYHFAKMIAEKCEEGTDKSSRTKNNLTALLAALCNYSHQQGNT
CLFLEEQIKSNLFGLAYRALEQDYLQQIDEKIGYLPVAQWQQILKSHIAFTTEPKTKIAP
FVFQFNALYFYRVWQDEYLVARYLKSAVKNSKVLAEQPDTKIIHQLIGENTGLNQGQKIA
IATALRQQFCLISGGPGTGKTYTVARLLVALQQLHQGKLQIKLAAPTGKAAARLTESIEN
ALQQMTLSAKLKHCIPTEAMTIHRLLGGRSFKFNAQNPLPLDVLVIDEASMIDLALMSNL
LQALPSHARLILLGDKDQLASVEAGAILGELGQFLEQGYSASFIDYLNRVTDSHLAFNSV
QGDEIRDYLSHLTESRRFDEKSAIGHLAKAINSAEIDRSLQLFSQLDDIEYVDFNRYFAN
GIQPESSAEYLAYCVNLVVERAVREYRDYLLEIETRSAKSELTEQDIEKIFAGFKKVRFL
SALRLGELGVEKLNLSIAEGLRRQNLIQFKNSRDWYQGKPVMIIQNDANVGLFNGDIGLF
IQGKVWFELGENHYRRISPSRIPSHETAFVMTVHKSQGSEFNHAFLVLPTENVPVLSREL
VYTAVTRAKQRFTLFATDNIWKSAVRKQVKRQSGLGRLLIENI
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaattttagcaaaattacaacaggaaaatgtgatcaccgcaggggattatcat
tttgccaaaatgattgcggaaaaatgcgaagaaggaacggataaaagttcaaggacaaaa
aataatttaacggctttacttgccgcactttgtaattacagtcatcagcaaggaaatact
tgtttattccttgaagaacagattaaatcgaatttattcgggctggcttatcgcgcttta
gagcaggattatttacaacaaattgatgaaaaaatcggatatttacctgtagctcaatgg
cagcaaatattaaaatcccatatcgcctttacaacagaaccgaaaacgaaaattgcacct
ttcgtttttcaattcaatgcgttatatttttatcgtgtttggcaggatgaatatttggta
gctcgttacctgaaaagtgcggtcaaaaatagtaaagttttggcagaacaaccggatacg
aaaataatccatcagctaatcggtgaaaataccggcttaaaccaagggcaaaagattgct
attgcaaccgcactccgtcaacaattttgcctgatttcgggcggaccgggaaccggaaaa
acctatacggtggcgagattattggttgctctacaacaactacatcaaggcaaattacag
ataaaattagccgcacccaccggaaaagccgccgcacgtttaacggaaagtattgaaaac
gccctacagcaaatgacgttgtctgcaaaattaaagcattgcattccaactgaggcaatg
acaattcatcgtttacttggcggacggagctttaaattcaatgctcaaaatcctttgccg
ttagatgtactggtaatagacgaggcctcaatgatagatttagcattgatgtcaaactta
ctgcaggccttgccaagccatgcgcgactgattttattaggtgataaagaccaactggcg
tcagtagaggccggagcgattttaggcgagttagggcagtttttagaacagggttacagt
gcttcctttatcgattatttaaaccgggtaacggattcgcatttggcgttcaactcggtt
caaggcgatgaaatccgggattatttatctcacttgacggaaagtcggcgttttgatgaa
aaatctgcaatcggacatttggcaaaagcaataaattccgcagaaattgaccgcagtttg
cagttgttttcccaattagatgatattgaatatgttgattttaaccgttattttgctaac
ggcattcagcccgaatcctccgctgagtatttagcttattgcgttaacctagtcgttgaa
cgtgcggtacgggaatatcgggattatctactggaaattgaaacccgatcagcaaaaagc
gaattaacggagcaggatatcgaaaaaatctttgccggtttcaaaaaagtgcgtttttta
tccgcacttcggcttggtgaattaggcgttgaaaagctgaatctgtctattgcggaaggt
ttgcgccgacaaaatttaattcaatttaaaaacagtagggattggtatcagggaaaaccg
gtgatgatcattcaaaatgatgccaacgtagggcttttcaatggcgatatcgggttgttt
attcaggggaaagtttggtttgaattaggcgaaaatcattatcgtcgcatttcgccaagc
cggataccgagccatgaaaccgcatttgtaatgacggtgcataaatctcaggggtcggaa
ttcaatcacgcatttttagtattgccgacggaaaacgtaccggtcttatccagagagctt
gtttataccgcggtgactcgcgcaaaacagcgattcactttgtttgctacggataatatc
tggaaaagtgcggtcagaaaacaggtaaaaagacaaagcggtttaggccgcttattgatt
gaaaatatttaa

DBGET integrated database retrieval system