KEGG   Mannheimia succiniciproducens: MS1111Help
Entry
MS1111            CDS       T00201                                 

Gene name
chb
Definition
Chb protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
msu  Mannheimia succiniciproducens
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MS1111 (chb)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MS1111 (chb)
Enzymes [BR:msu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MS1111 (chb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1093885..1095393
Genome map
AA seq 502 aa AA seqDB search
MMIFSSCKTPNHFLCAIFIGFGLNIPQTYAETVTQQFQKAFSSAEVSEKKESGLALDIAR
HFYSAETIKNFIDTIHKNGGTFLHLHFSDHENYAIESTILDQRAENARRDENGFYVNPKT
GKPFLTYEQLKDIMDYAKQKNVELIPELDSPNHMTAIFNLLAEKNGKDYVQKLRSKWTNE
EIDITNPDSIAFMTSLIEEVVWIFGNSTKHFHIGGDEFGYSEENNHEFINYANKLSAFLK
EKGLKTRIWNDGLIKSTIDQLDPNIQVTYWSYDGNTQNKQAARQRRTMRISMPELIERGF
SVLNYNSYYLYFNPKESPNISKDSDFAMRDVIKNWDLSIWDEKNTQNKVAEPNKISGSAL
AIWGEYAGSLKGDSIHKATENLLKAIIYKTNAAGDSTGTISRKLQQLDFAQINANSYIDL
MQVRNNESVTLENYPQTVHLLQTNALSGKKRVLWVSGSHVHKIRLEPQWQKTGLNEKRNG
KSYTAYKYQDNILWLDDNITEQ
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
ttgatgattttttcttcatgtaaaacccctaatcattttctttgcgcaatttttatcgga
tttggattgaatattccgcaaacgtacgccgaaacggtcactcaacaatttcaaaaagcg
ttctcctctgccgaagtgtcggaaaaaaaagaatcaggactggcactggatattgctcgt
catttttattctgctgaaacaattaaaaattttattgataccattcataaaaacggcggt
acttttttacatttacatttttccgatcatgaaaattatgcaatcgaaagtactattcta
gatcaacgcgctgaaaatgcgcgtcgtgatgaaaacggcttttacgtcaatcctaaaacc
ggcaaaccctttttaacctatgagcagttaaaggatattatggattatgccaagcagaaa
aatgtagaactaattcccgaattagatagtccgaatcacatgacggcaatttttaatttg
ttagcggaaaaaaacggtaaggattatgtacaaaaattacgttcaaaatggacaaatgaa
gaaattgatatcaccaatcccgattcaatagcttttatgacgtctttaattgaagaagtc
gtctggattttcggcaattccaccaaacattttcatataggtggcgatgaatttggctat
agtgaggagaataatcatgaatttattaactatgccaataaattatcagcttttttaaaa
gaaaaaggtttaaaaacccgcatttggaatgacggtttaattaaaagcaccattgaccaa
ttggatccgaatattcaggtaacttattggagttatgacggcaatacgcaaaataaacag
gctgctcggcaacggcggacaatgcgtatcagtatgccggaattaattgaacgcgggttc
tccgtactaaactataattcttattacttgtattttaatcccaaagaaagtccgaatata
tcaaaagatagcgattttgctatgcgggatgtgattaaaaattgggatttaagcatttgg
gatgaaaaaaatacccaaaataaagtggctgaacccaataaaatttcaggttccgcttta
gctatttggggtgaatatgccggctcactaaaaggcgattccattcataaagccaccgaa
aatttactcaaggctattatttataaaaccaacgcagccggcgatagtaccgggacaata
agcagaaaattacaacagctggattttgctcaaataaatgcaaactcttatattgacctg
atgcaagtaagaaataatgaatccgtcacattggaaaattatccgcaaactgttcattta
ctacaaaccaacgcactttcaggtaaaaaacgtgtcctctgggtcagtggctcgcatgta
cataaaatacggcttgaacctcagtggcagaaaacgggtttgaatgagaaacgtaacggc
aagtcttatacggcttataaatatcaagacaacattctttggcttgacgacaatatcacc
gagcaataa

DBGET integrated database retrieval system