KEGG   Mannheimia succiniciproducens: MS1124Help
Entry
MS1124            CDS       T00201                                 

Gene name
malQ
Definition
MalQ protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
msu  Mannheimia succiniciproducens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:msu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1112859..1114949)
Genome map
AA seq 696 aa AA seqDB search
MSELQQAAQLGIALSYYDIEGRLIQAKEETLQYFTALFQPSPDGKNKSTKQFHDVFVMNA
QERAIYEFQRLALSPSACEYQLFDEQNKLCGVQTLSDPKSLSLPPLEAGYYLLKLKCNDA
EYRIRLLVQPSTAYQPPLLERKKAWGLNVQLYSLRSTRNWGIGDFADLRNLIKSAVKFGA
DFIGINPLHLVYPAVPEWASPYSSSSRRWLNCIYLDIESLPEYTLSKLAKKWRVEHNEQI
EQLRKAELVDYATVNQLKQSALALLFDFFNRSKSAQIAARRTEFNVFVENQGEALLYQGL
FNVLDSIEHVDLPENENQIGWLGWRKEWQHLTSKKRKALLKEHQKQVYFYAWQQWLAEQQ
LAEAESLCLTEGMQLGIYGDLAVNSSRGSSDVWSDQKLYCINASVGAPPDPLGPVGQNWN
LPPYNPNQLKRRGFQPVIDMLRANMRHFGVLRIDHVMGLFRLWLIPEGKTAADGVYVHYP
FNELMAILAIESQRNQCLIIGEDLGTVPDEVRSKLKEFQILSYFVVYFSNQNGEFPQGKD
FPVNAFATIGTHDVPSLAGFWHCRDLALFAQLDVLKDDLLKAKYDQRLTDKQALLDRLRL
DGYLPADYQGDALNMAMHDNLNLVIHRYLAESASQLVGVQLENLLNQEVSFNLPGTSTEY
PNWRKKLAVNLDDIFNDERIIALLKTINYARSQPKS
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaattacaacaagcggcgcaattaggcattgccttatcttattacgatatagag
gggcgcctgattcaggcaaaagaagaaacattgcagtattttaccgcactttttcaacct
tcgcccgacggcaagaacaaaagtactaagcagtttcatgatgtttttgtgatgaatgcg
caagagcgcgcaatctatgaattccaacgtcttgctttatctccctctgcctgcgaatat
caactattcgatgaacaaaataaactttgtggcgtacaaactctctctgacccaaaatcc
ctttctttgccgccccttgaagccggctattatctgttaaaactaaaatgtaatgatgcc
gaatatcgtattcgacttttagttcaaccctcaaccgcgtatcaaccacccttgttagaa
cgtaaaaaagcatgggggctaaacgttcaattatatagtttgcgctcaacccgcaattgg
gggataggcgattttgccgatttgcgtaatttaattaaaagtgcggtcaaattcggtgcg
gattttatcggtattaacccgctacatttggtttaccctgcggtacccgaatgggctagc
ccttacagttcgtcttctcgtcgctggttaaactgtatttatcttgatattgaaagctta
ccggaatataccttatctaaattagctaaaaagtggcgagttgaacataatgagcaaata
gaacaattgcgcaaagccgaattagtggactatgcgacagtcaatcaattaaaacaaagc
gcgcttgcgttactatttgatttctttaatcgcagtaaatccgcacaaattgcggcacgg
cgcactgaatttaacgtttttgtagaaaatcaaggcgaagccttgttatatcaaggttta
ttcaatgtgctggatagtattgaacacgttgatttaccggaaaatgaaaatcaaatcggt
tggttaggttggcgaaaggaatggcagcatttaacgtcgaaaaaacgcaaagccttgcta
aaagaacaccaaaaacaagtttatttttatgcctggcaacaatggttggcagaacaacag
cttgccgaagcggaatctctttgtttaaccgaaggtatgcagttaggcatatacggcgat
ttagcggtcaatagttcaagaggcagttccgatgtgtggtctgatcaaaaattatattgc
attaacgcttccgtcggggctccgccggatccattaggcccggtaggacaaaactggaat
ttgccgccttacaatccgaatcagttaaaacgtcgtggtttccaacccgttattgatatg
ttgcgcgccaatatgcgacatttcggcgttttgcgcattgatcatgtgatgggtttattt
cgcttatggttgatcccggaaggcaaaaccgctgcagacggtgtttatgtacattatccg
ttcaatgaattaatggcgattcttgctattgaaagccaacgcaatcaatgccttattatc
ggtgaagatttgggtaccgtgcctgacgaagtgcggtcgaaattgaaagaatttcaaatt
ttatcttattttgttgtttatttttccaatcaaaacggtgaattcccgcaaggtaaagat
tttccggttaacgcgtttgctactatcggcactcatgatgtaccgtctttagccggtttt
tggcattgtcgggatttagccctttttgcacagttagatgtgttgaaagatgatttatta
aaagcaaaatatgatcagcgcctcaccgataagcaagccttgttagaccgtttacgttta
gatgggtatttgccggcggattatcaaggcgacgcactaaacatggcaatgcacgataat
ttaaatttagtgattcaccgttatttggcggaaagcgcgagccaattggtcggtgtccag
ctagagaacttattaaaccaagaagtttcttttaatttgccgggtacgtctacggaatat
cccaactggcgtaaaaaattagcggtaaatttagacgatatttttaatgatgaacgaatt
atagctttacttaaaacaattaattatgctcgttcgcaaccaaaatcatag

DBGET integrated database retrieval system