KEGG   Mannheimia succiniciproducens: MS1153Help
Entry
MS1153            CDS       T00201                                 

Gene name
trpB
Definition
(GenBank) TrpB protein
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
msu  Mannheimia succiniciproducens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:msu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MS1153 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MS1153 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MS1153 (trpB)
Enzymes [BR:msu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MS1153 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1140635..1141831
Genome map
AA seq 398 aa AA seqDB search
MTDTILDPYFGEFGGMYVPEILIPVLKQLEKAFVEAQQDPAFQTEFLDLLKNYAGRPTAL
TLCRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVAT
ALACAMLGMPCRIYMGAKDVERQSPNVFRMRLMGAEVFPVTKGSSTLKDACCEAMRDWAA
NYENTHYLIGTAAGPHPFPTIVREFQKMIGEETKAQILQREGRLPDAVIACVGGGSNAIG
MFTDFINETSVRLIGVEPAGKGIETGEHGAPLGHGKPGIYFGMKSPIMQTEDGQIEESYS
ISAGLDFPSVGPQHAYLNSIGRAEYPSITDDEALEAFKELAQHEGIIPALESSHALAYAL
KMARQNPMREQLLVVNLSGRGDKDIFTVDKIFSERGML
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacagacacaattttagatccctactttggagaattcggcggcatgtatgttcccgaa
attcttattccggttttaaaacaattggaaaaagccttcgttgaagcgcaacaagatccc
gctttccagaccgaatttttagatttactaaaaaattatgccggtcgccccacagcatta
accctttgtcgcaatttgaccaaaggtacaaaaaccaaactctatttaaaacgtgaagat
ttgctgcacggcggcgcgcataaaaccaatcaagtattagggcagattttgctggctaaa
cgcatggggaaaacccgcattattgcggaaaccggcgccggtcagcacggggttgctacc
gctcttgcctgtgcgatgttaggtatgccttgccgcatttatatgggtgcgaaagatgtt
gagcgtcaatcgcctaatgtgttccgtatgcgtttaatgggtgcggaagtgttcccggtt
acaaaaggttccagcaccttaaaagacgcctgttgtgaagctatgcgcgactgggcggct
aattatgaaaacacccattatttaatcggtaccgctgccggccctcacccgttcccgact
attgtccgcgaatttcaaaaaatgatcggtgaagaaacgaaagcgcagattttacaacgt
gaaggtcgtctgcctgacgcggtaattgcttgcgtaggcggcggttcaaacgctatcggt
atgtttaccgattttattaacgaaacatccgtacgattaatcggtgtggaacctgccggc
aaaggcattgaaaccggcgaacacggcgcacctttaggccatggcaagcccggtatttac
ttcggcatgaaatcaccgattatgcaaacggaagacggccagatcgaagaatcttacagt
atttccgcaggcctggacttcccttccgtcggcccgcaacatgcctatttaaattctatc
ggtcgtgccgaatatccgagcattaccgatgacgaagcgcttgaggcatttaaagaatta
gcccaacacgaaggcattattccggcgttggaaagctctcacgctttagcctatgcgtta
aaaatggcgcgccaaaatccgatgcgggaacaattattagtagtgaatttatccggtcga
ggcgacaaggatatttttaccgtggacaaaatttttagtgaaagaggtatgctttaa

DBGET integrated database retrieval system