KEGG   Mannheimia succiniciproducens: MS1154Help
Entry
MS1154            CDS       T00201                                 

Gene name
trpA
Definition
(GenBank) TrpA protein
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
msu  Mannheimia succiniciproducens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:msu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MS1154 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MS1154 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MS1154 (trpA)
Enzymes [BR:msu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MS1154 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1141831..1142637
Genome map
AA seq 268 aa AA seqDB search
MARFETLFAQLNAKKQGGFVPFVTLCDPDLERSFDIICTLVDNGADALELGFPFSDPLLD
GPVIQAANNRALNAGCSTAESFKLLEKVRSKYPEIPIGLLLCANLIYAQTLDGFYRRCAE
IGIDAVLVADIPLLAAEPYIQAAKKHGIQPVFICPPNADENTVKGVAEHSEGYTYLVSRA
GVTSAENQSHAANLDSLVEQLKAHNAPPILQGFGIAKPQQVKEALNMGVAGAISGSATVK
IIEANLDNHEKCLADLAEFVKNMKAATL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggctcgttttgaaactctatttgcacaacttaatgcaaaaaaacaaggcggattcgtg
ccattcgtgacattatgcgatcctgatcttgaacgttcttttgatattatctgcaccctt
gtagataacggtgcggatgccctggaactcggtttcccgttttccgatccgttattggac
ggccccgttattcaggcggcgaataatcgcgcattaaacgccggttgcagtactgcagaa
agctttaaattactggaaaaagtgcggtcaaaatatccggaaattccaatcggtttactg
ctttgcgccaatctgatttatgcgcagactttagacggcttttatcggcgctgcgccgaa
atcggtatcgatgcggttttagtagcggacattccgctattagccgccgaaccttacatt
caggcggctaaaaaacacggtattcaacctgtatttatttgcccgccgaatgccgatgaa
aatacggtaaaaggcgttgccgaacattccgagggttacacatatttagtttctcgagcc
ggcgttaccagtgcggaaaatcaaagccatgcggcaaatttagacagtcttgtagaacaa
cttaaagcccacaatgcgccgccgattctgcaaggcttcggtatcgcaaaaccacaacaa
gtgaaagaggcgctgaatatgggcgttgccggtgctatttcaggctccgcgacagtaaaa
attattgaggcgaatttagataatcatgagaaatgtttggcggatttagctgaatttgtc
aagaatatgaaagcggcaaccttatag

DBGET integrated database retrieval system