KEGG   Mannheimia succiniciproducens: MS1154Help
Entry
MS1154            CDS       T00201                                 

Gene name
trpA
Definition
(GenBank) TrpA protein
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
msu  Mannheimia succiniciproducens
Pathway
msu00260  Glycine, serine and threonine metabolism
msu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
msu01100  Metabolic pathways
msu01110  Biosynthesis of secondary metabolites
msu01130  Biosynthesis of antibiotics
msu01230  Biosynthesis of amino acids
Module
msu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:msu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MS1154 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MS1154 (trpA)
Enzymes [BR:msu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MS1154 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth NanE
Motif
Other DBs
NCBI-ProteinID: AAU37761
UniProt: Q65TE9
Position
1141831..1142637
Genome map
AA seq 268 aa AA seqDB search
MARFETLFAQLNAKKQGGFVPFVTLCDPDLERSFDIICTLVDNGADALELGFPFSDPLLD
GPVIQAANNRALNAGCSTAESFKLLEKVRSKYPEIPIGLLLCANLIYAQTLDGFYRRCAE
IGIDAVLVADIPLLAAEPYIQAAKKHGIQPVFICPPNADENTVKGVAEHSEGYTYLVSRA
GVTSAENQSHAANLDSLVEQLKAHNAPPILQGFGIAKPQQVKEALNMGVAGAISGSATVK
IIEANLDNHEKCLADLAEFVKNMKAATL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggctcgttttgaaactctatttgcacaacttaatgcaaaaaaacaaggcggattcgtg
ccattcgtgacattatgcgatcctgatcttgaacgttcttttgatattatctgcaccctt
gtagataacggtgcggatgccctggaactcggtttcccgttttccgatccgttattggac
ggccccgttattcaggcggcgaataatcgcgcattaaacgccggttgcagtactgcagaa
agctttaaattactggaaaaagtgcggtcaaaatatccggaaattccaatcggtttactg
ctttgcgccaatctgatttatgcgcagactttagacggcttttatcggcgctgcgccgaa
atcggtatcgatgcggttttagtagcggacattccgctattagccgccgaaccttacatt
caggcggctaaaaaacacggtattcaacctgtatttatttgcccgccgaatgccgatgaa
aatacggtaaaaggcgttgccgaacattccgagggttacacatatttagtttctcgagcc
ggcgttaccagtgcggaaaatcaaagccatgcggcaaatttagacagtcttgtagaacaa
cttaaagcccacaatgcgccgccgattctgcaaggcttcggtatcgcaaaaccacaacaa
gtgaaagaggcgctgaatatgggcgttgccggtgctatttcaggctccgcgacagtaaaa
attattgaggcgaatttagataatcatgagaaatgtttggcggatttagctgaatttgtc
aagaatatgaaagcggcaaccttatag

DBGET integrated database retrieval system