KEGG   Mannheimia succiniciproducens: MS1354Help
Entry
MS1354            CDS       T00201                                 

Gene name
aceF
Definition
AceF protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
msu  Mannheimia succiniciproducens
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:msu01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:msu00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:msu00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1356858..1358066)
Genome map
AA seq 402 aa AA seqDB search
MSNFDIITPDLPESVADATVVKWHKAVGDKVRRDEVLVEIETDKVVLEVPALNDGIIESI
IEPEGATVVSKQLLGKAALLPVGEVTVRAETPTVAPQIEDSAVASSADTLGPAARRLIAE
HDLNVNEIKGSGVSGRITREDVEAVIAQKAASVAAKSAVENTVISSPAAVRTEKRVPMTR
LRKRVAERLLEVKNSTAMLTTFNEVDMQPIMQLRKKYAEKFEKQHDTRLGFMSFYVKAVV
EALKRYPVINASIDGDDIVYHNYFDISIAVSTPRGLVTPVIRNCDKLSMAEIERQIKALA
EKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINPPQAAILGMHAIKDRPVAIDGQVA
IRPMMYLALSYDHRLIDGKDSVGFLVTVKELLEDPTRLLLEI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtaactttgatattatcacccctgatttaccggaatccgtggcggatgcaaccgtt
gtaaaatggcataaagcggttggcgataaagtacggcgcgacgaagtattggttgaaatt
gaaacggataaagttgtactggaagtaccggcgctaaatgacggtattatcgaatctatc
atagagcccgaaggggcaacggttgtaagcaaacaattattaggcaaggcggcattgctt
ccggtaggcgaagtaaccgtacgggcggaaacaccgacggtggcgccgcaaattgaggat
tcagccgttgcgtcctctgccgataccctagggcctgccgctcgccgcttaattgccgag
catgatttaaatgttaatgaaattaaaggcagtggggtgagcggtcgcattacccgtgaa
gatgtggaagcggtgatcgcacaaaaagccgcatcggttgccgcgaaaagtgcggtggaa
aataccgtaatttcgtcgccggcagccgttcgcacggaaaaacgcgtgccgatgacccgt
ttgcgtaaacgggtggcggagcgtttgctggaagtgaaaaacagtaccgcaatgttaacc
actttcaacgaagtggatatgcaacctattatgcagttacgcaaaaaatatgctgaaaaa
tttgaaaagcagcatgacacccgattaggttttatgtccttttatgtgaaagcggttgtg
gaagcattgaagcgttatccggtaatcaatgcatctattgatggtgacgacattgtttat
cacaattattttgatatcagcatcgccgtttccaccccgcgcggtttggttacgccggtt
atccgtaattgcgataaattgagcatggctgaaatcgaacgccaaattaaagcgctggcg
gaaaaaggccgtgacggtaaattaacggtggatgatttaaccggcggtaactttaccatt
acaaacggcggcgtattcggttcattaatgtctacgccgatcattaacccgccgcaagcg
gctattttaggtatgcacgccattaaagaccgcccggtggctattgacggacaggtagcg
attcgcccgatgatgtatttagcattgtcttacgaccaccgtcttattgacggcaaagat
tccgtcggttttttagttacggtcaaagagcttttagaggatccgaccagattattgtta
gaaatttag

DBGET integrated database retrieval system