KEGG   Mannheimia succiniciproducens: MS1362Help
Entry
MS1362            CDS       T00201                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
msu  Mannheimia succiniciproducens
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MS1362
Enzymes [BR:msu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     MS1362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1367245..1368219
Genome map
AA seq 324 aa AA seqDB search
MLGTGAEILNIRAELPPLGKSRFNLIYISHCVIRLSFPIKFALYCIKPNEQKGNFMESKL
IKQITPAISLHQYNEIPVIKLNHAVGQAEIALQGAHLFSWKPAYCPQDVLWLSEIEPFKL
GTAIRGGIPICYPWFNNAGTPSHGFARISLWQLSDYEVSAEKVRLEFSLFSEQRLIIAKI
QFVFTGECEITFTNYAEENAQAALHTYFRVGDIRQLELYNLPTRVFNSLTQTEENVPSPR
TIGELVDCVYSAELGATLIQDNQLNRKINVEHINASDIVVWNPWHKPTGGMSETGYQTMV
CVESARINKRLNSGERLGVKISLR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
ttgctcggaacgggggcggaaatccttaatattcgagctgagttgcccccgctcggaaaa
agccgctttaatttgatctatattagccattgtgtaattcgattatctttccctataaaa
tttgcgctatattgtatcaaacccaatgaacaaaaaggaaattttatggaatctaaatta
attaaacaaataacgccggctataagcttacatcaatataatgaaattccggtaattaag
ctcaaccacgccgtcggacaagcggaaatcgccttgcaaggcgcacatctgtttagttgg
aaacccgcctactgcccacaagatgtactttggttaagtgaaatcgagccgttcaaactc
ggtaccgcaatcagaggcggcattcctatttgttatccttggtttaataatgccggtacg
ccttcacacggatttgcccgaatcagtttatggcaacttagcgattatgaagtttccgct
gaaaaagtgcggttggaattttcattattttcagaacaacggctgattattgccaaaata
caattcgtcttcaccggagaatgcgaaattacctttacgaattacgcggaagaaaacgcc
caagcagccttacatacttactttcgggtgggcgatattcgtcagctggaattatataac
ttaccaacccgcgtttttaattccttaactcaaacggaagaaaatgttccttcgccgaga
accatcggcgaattagtggattgcgtttattccgccgaacttggcgcaaccttaattcag
gataatcaattaaaccgtaaaatcaatgtagaacatattaatgcaagcgatattgtggtt
tggaacccatggcataagccgacgggcggtatgagtgaaacgggttatcagacaatggtt
tgcgtagaaagcgcgagaatcaataaacggttgaattcaggtgaacggttaggggtgaaa
attagcctgagataa

DBGET integrated database retrieval system