KEGG   Mannheimia succiniciproducens: MS1540Help
Entry
MS1540            CDS       T00201                                 

Gene name
dsbG
Definition
(GenBank) DsbG protein
  KO
K03981  thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
msu  Mannheimia succiniciproducens
Brite
Enzymes [BR:msu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MS1540 (dsbG)
Chaperones and folding catalysts [BR:msu03110]
 Protein folding catalysts
  Protein disulfide isomerase
   MS1540 (dsbG)
Secretion system [BR:msu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   MS1540 (dsbG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_2 DsbC_N Thioredoxin_4 DSBA Thioredoxin LYTB
Motif
Other DBs
NCBI-ProteinID: AAU38147
UniProt: Q65SB3
Position
complement(1531321..1532010)
Genome map
AA seq 229 aa AA seqDB search
MKKFVTALSLMAISMAATADNAQITTQLKKLGATNIEVKDSPISGIKTVVTNEGVLYTTE
DGKYVLQGKLFELTDKGPVDVTGKALLATLESYKNEMIVYPAKNEKHVVTVFMDITCGYC
QKLHSEIKEYNDLGITIRYLAFPRGGLGTKTAKEMEAIFTAKDPAFALDEAEKGNPPKEL
KAVNITKKHYELGVQFGVRGTPSIVTRSGELIGGYLPPKELLSALESVK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatttgtaaccgcactttcattaatggctatttcaatggcagctacggctgat
aatgcgcaaattacaactcaattaaaaaaattaggcgcaaccaatattgaagtgaaagac
tcacctatttcaggtattaaaaccgtagtaacgaacgaaggcgttctttataccaccgaa
gacggtaaatatgtgttgcaaggtaaattattcgaattaacggataaagggccggtggat
gtaaccggcaaagctttgttagcgacattagaaagctataaaaacgaaatgattgtctat
cctgcaaaaaatgaaaaacacgtggtgaccgtttttatggatattacttgtggctattgt
caaaaattacatagtgaaatcaaggaatataacgatttaggtattaccattcgttattta
gcttttccgcgcggcggtttaggaacgaaaacggcaaaagaaatggaagcgatttttacc
gctaaagatcccgcatttgcattagacgaagcggaaaaaggcaatccgccgaaagaatta
aaagcggtgaatatcacgaaaaaacattatgaattgggcgttcaattcggtgttcgcggt
acgccgagtattgtgacccgaagcggtgaattaatcggcggctatttaccaccgaaagaa
ttattatccgctttagaaagcgtaaaataa

DBGET integrated database retrieval system