KEGG   Mannheimia succiniciproducens: MS1701Help
Entry
MS1701            CDS       T00201                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
msu  Mannheimia succiniciproducens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:msu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MS1701 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MS1701 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MS1701 (thrC)
Enzymes [BR:msu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MS1701 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1692235..1693512)
Genome map
AA seq 425 aa AA seqDB search
MNLYNIKHPEEQVNFAQAVRQGLGKDQGLFFPEVIPALDNIDELLALPLVERSQKILGAL
IGEEIPAEKLNTMVKNAFTFPAPVAKVEEGVYALELFHGPTLAFKDFGGRFMAQALATVR
GDGKITILTATSGDTGAAVAHAFYGLENIDVVILYPQGKISPLQEKLFCTLGGNIRTVAI
NADFDACQALVKQAFDDEELRRAIGLNSANSINISRLLAQVCYYFEAAAQLSPSERSNLV
VSVPSGNFGNLTAGLIAKTLGLPIKRFIASTNANDTVPRYLAKGKWEPNATVATLSNAMD
VSRPNNWPRVEELFKRNGWALSELHSGAVSDAQTEETLRDMNAKGYLCEPHGAIAYRVLK
QDLQAGETGLFLCTAHPAKFKESVERILNTQLPLPQALAKHAELPLLSDVMENDFAALRA
YLLKK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaatctatacaacattaaacacccggaagaacaagtaaattttgcccaggcggtacgc
caggggttgggaaaagatcagggattattttttcctgaagtgattccggctttagataat
attgacgaattattagccttgccgttagtggaacgcagtcaaaaaatcttaggcgctcta
atcggagaagaaattccggcggaaaaactcaataccatggtgaaaaacgcgttcactttt
ccggctccggtggcaaaggtagaagagggcgtttatgcattggaattatttcatggcccg
actttagcctttaaagatttcggcggccgttttatggcgcaggcgttagcgacagtgcgc
ggcgacggcaaaattaccatcttaaccgcgacttcgggcgataccggggcggcggttgct
catgcattttacggtttggaaaatattgatgtggtgattctttatccgcaaggtaaaatc
agcccgttacaggaaaaattattctgcacattaggcggcaatatccgtaccgtcgcgatt
aatgcggattttgacgcttgccaggcgttggtaaaacaagcttttgatgatgaggaattg
cgtcgggcgatcggtttaaattccgcaaattccattaatatcagccgtttactggctcag
gtttgctattattttgaagcggcggcacaactttcgccttcagagcgcagcaatctggtg
gtttccgtaccaagcggtaacttcggtaatttaaccgccggattaatcgcgaaaacctta
ggtttgccgattaagcgttttatcgcttccaccaatgccaatgatacggttccgcgttat
ctggcaaaggggaaatgggaacctaacgcaacggtggcaactttatctaacgccatggat
gtcagccgcccgaataactggccgcgtgtcgaagaattgtttaaacgtaacggttgggct
ttatccgagttgcattcgggtgcggtttccgacgcacaaacggaagaaaccctacgcgat
atgaatgcaaaaggttatctgtgcgaacctcacggcgccattgcttatcgcgtattgaaa
caggacttgcaagcgggcgaaaccggtttgttcctgtgcacggcgcatccggcgaagttt
aaagaatccgttgaacgcattcttaacacccaattaccgcttccgcaggcgcttgcaaaa
catgcggaattaccattgctttccgatgtaatggaaaatgattttgccgcattgcgcgct
tatttattgaaaaaataa

DBGET integrated database retrieval system