KEGG   Mannheimia succiniciproducens: MS1862Help
Entry
MS1862            CDS       T00201                                 

Gene name
proB
Definition
(GenBank) ProB protein
  KO
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
msu  Mannheimia succiniciproducens
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:msu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MS1862 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MS1862 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MS1862 (proB)
Enzymes [BR:msu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MS1862 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1852239..1853324
Genome map
AA seq 361 aa AA seqDB search
MKFGTSTLTQGTPKLNRAHMIEIVRQLAQLHQEGYRLVIVTSGAMAAGRHYLNHPKLPPT
IASKQLLAAVGQSQLIQTWEQLFAIYDIHIGQLLLTRADIEDRERFLNARDTLHALLDNR
IIPVVNENDAVATAEIKVGDNDNLSALVAILVQAEQLYLLTDQQGLFDSDPRKNPQAKLI
PVVNEITDHIRSIAGGSGTTLGTGGMSTKITAADIATRSGIETIIAPGNRENVIADLAHG
EAIGTKFTVQTDKLESRKQWLFAAPSAGILTIDQGAENAILEQHKSLLPAGIVNIEGRFS
RGEVVKIRTQQGKDIALGMPRYNSDALYLIQGKKSQNIEKILGYEYGSVAIHRDDMIVLN
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattcggtaccagcacattaactcaaggtacgccaaaattaaatcgcgcccacatg
atcgaaatcgtgcgtcaattggcgcaattacatcaggaaggttatcgtcttgtaattgtc
acatccggcgcaatggcggcgggcaggcattatcttaatcacccgaaacttccgcccaca
atcgcctcaaaacaattattggcggcggttggacaaagccagctgattcaaacgtgggaa
caactatttgccatttacgatattcatatcggtcagcttttattaacccgcgccgatatt
gaagaccgcgaacgctttttaaatgccagagatacgcttcacgcgttattggataaccgc
attattccggtcgtaaatgaaaacgacgccgtcgccaccgcagaaatcaaagtaggcgat
aacgacaacttatcggcgttagtggcgattttagtacaggcggaacaactttatttgctc
accgaccaacaaggattatttgactccgatccgcggaaaaatccacaggcaaagctaatc
ccggtggtaaatgaaattaccgatcatattcgttctattgccggcggtagcggtacaacc
ttaggcacaggcggaatgtccaccaaaattaccgccgccgacattgcaacccgttccggc
attgaaacaatcattgctccgggaaacagggaaaatgttatcgccgatcttgcccacggc
gaagctataggtacgaaatttacggttcagaccgataaactggaaagccgtaaacaatgg
ctctttgccgcgccttccgccggcattctgaccatcgatcaaggggcggaaaatgcaata
ttagaacaacataagtctttattgccggcgggtattgtaaatattgaaggtcgtttctcc
cgcggagaagtggtaaaaatccgcacccaacaaggcaaagatatcgcccttggcatgccg
cgttacaacagcgatgcgctttatctcattcaaggcaaaaaatctcagaatattgaaaaa
attctgggttatgaatacggctctgtggcgattcaccgcgatgatatgatcgtgttaaac
aaataa

DBGET integrated database retrieval system