KEGG   Mannheimia succiniciproducens: MS1928Help
Entry
MS1928            CDS       T00201                                 

Gene name
dxr
Definition
(GenBank) Dxr protein
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
msu  Mannheimia succiniciproducens
Pathway
msu00900  Terpenoid backbone biosynthesis
msu01100  Metabolic pathways
msu01110  Biosynthesis of secondary metabolites
msu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:msu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MS1928 (dxr)
Enzymes [BR:msu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     MS1928 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: AAU38535
UniProt: Q65R75
Position
complement(1909494..1910729)
Genome map
AA seq 411 aa AA seqDB search
MRMPAGFLINAMKKQNLVILGSTGSIGKSTLSVIEHNPEKYHAFALVGGRNVDLMVEQCV
KFQPEFAALDDENAAKQLAEKLKSAGKKTKVLAGQKAICELAAHPEADQVMAAIVGAAGL
LPTLSAVQASKTVLLANKETLVTCGQIFIDEVKRTKARLLPVDSEHNAIFQSLPPEAQQQ
IGFCPLKELGINKIVLTGSGGPFRYTDLTEFDNITPEQAVAHPNWSMGKKISVDSATMMN
KGLEYIEARWLFNAGAEEMEVIIHPQSIIHSMVRYIDGSVIAQMGNPDMRTPIAETMAYP
GRIVSGVTPLDFYQLSGLTFLEPDYERYPCLKLAIEAFAAGQYATTAMNAANEIAVEAFL
NRMIKFTDIARVNAKVVELIQPQQINCIDDVLAVDKQSRLVAKEVIVSLKA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
ttgcggatgccggcaggcttccttattaacgctatgaaaaaacaaaacttagttatctta
ggctcgaccggttcaatcggcaaaagcacgctttccgttatcgaacataatcctgaaaaa
tatcacgctttcgcgttggtaggcggtcgcaacgtggatttaatggttgagcagtgcgtg
aaatttcagccggaattcgccgcgcttgatgatgagaacgcagccaaacagttagcggaa
aaattaaaaagtgcgggcaaaaaaacgaaagttttggcggggcaaaaagctatttgcgaa
ttggcggcgcaccctgaagcggatcaggtaatggcggcgattgtcggtgcggcggggttg
ctcccgacattatcggctgtgcaggcgagtaaaacggtattgcttgctaataaagaaacc
ctggttacttgcgggcagatctttattgatgaagttaaacgtaccaaagcacgcttattg
ccggtagatagcgaacataatgcgattttccaatcgcttcctcccgaggcgcagcaacaa
atcggtttttgtccgttaaaagaattggggatcaataagattgtattaaccggatccggc
ggtccgttccgttatacggatttgacggaattcgacaatattacgcccgaacaggcggta
gcgcatcctaactggtcaatgggcaagaaaatttccgttgattccgctaccatgatgaat
aaagggctggaatatattgaagcccgttggttgtttaatgccggcgcggaagaaatggaa
gtgattattcatccgcaatctattattcattcgatggtgcgttatattgacggttccgtt
atcgcacagatgggtaaccccgatatgcgaacgccgattgcggaaaccatggcttatccg
gggcgaattgtttcgggcgttacgccgttagatttttatcagctaagcggattaactttc
ttagaacccgattatgagcgctatccttgtttaaaattagcgatagaggcttttgccgca
ggtcagtatgcaaccacggcaatgaatgcggcaaatgaaatcgcggtcgaagcattttta
aatcggatgataaaattcaccgatattgcgcgagtgaatgccaaggtggtggaattaatt
caaccgcagcagattaattgtattgatgatgtattggcggttgataagcagtcccgtttg
gtggcaaaagaggtgatcgtttctttgaaagcataa

DBGET integrated database retrieval system