KEGG   Mannheimia succiniciproducens: MS2321Help
Entry
MS2321            CDS       T00201                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
msu  Mannheimia succiniciproducens
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:msu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MS2321 (gpmA)
   01230 Biosynthesis of amino acids
    MS2321 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MS2321 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    MS2321 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MS2321 (gpmA)
Enzymes [BR:msu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MS2321 (gpmA)
Exosome [BR:msu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MS2321 (gpmA)
  Exosomal proteins of melanoma cells
   MS2321 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2249865..2250548
Genome map
AA seq 227 aa AA seqDB search
MELVFIRHGLSEWNALNLFTGWRDVNLSEKGVEEAKEAGRKLKAAGFEFDIAFTSVLTRA
IKTCNLVLEESNQLWVPQIKTWRLNERHYGGLQGLNKAEAAAEHGDEQVRIWRRSYDVLP
PVLDPKDPNSAHNDRRYAHLPADVVPDCENLKVTLERVLPFWEDQIAPAIKAGKRVLVAA
HGNSLRALAKHIEGISDADIMDLEIPTGQPLVYTLDDNLKVVSKRYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaattagtatttattcgtcacggtttaagtgaatggaatgcattaaaccttttcacc
ggctggagagacgtaaacttaagtgaaaaaggcgtggaagaagcaaaagaagcgggtcgt
aaattaaaagccgcaggcttcgaatttgatatcgcgttcacttcagtattaacccgtgcg
atcaaaacctgtaacttagtgttagaagaatctaaccaattatgggttccgcaaatcaaa
acatggcgtttgaacgaacgccactacggcggtttacaaggtttaaacaaagcggaggca
gcggctgaacacggtgacgaacaagttcgtatttggcgccgttcatacgatgtgttaccg
ccggttttagatccaaaagaccctaactccgcacacaacgaccgtcgttacgcacattta
ccggcggatgttgtgcctgattgtgaaaacttaaaagtaactttagaacgcgttttacca
ttctgggaagatcaaatcgcaccggcaattaaagcgggcaaacgtgttttagttgcggca
cacggtaactcattacgcgcacttgcaaaacacattgaaggtatttccgatgcggatatc
atggacttggaaatccctaccggtcaacctttagtttatactttagacgacaacttaaaa
gtagtaagcaaacgctacttataa

DBGET integrated database retrieval system