KEGG   Meiothermus silvanus: Mesil_0076Help
Entry
Mesil_0076        CDS       T01246                                 

Definition
acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
msv  Meiothermus silvanus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mesil_0076
  Amino acid metabolism
   00300 Lysine biosynthesis
    Mesil_0076
Enzymes [BR:msv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Mesil_0076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
75010..76224
Genome map
AA seq 404 aa AA seqDB search
MQDAQDLARQAAQAVDAEEVVRLAQRLVQIESYYPGPGEGPVVDYLEPYLRERGFKTTLQ
AVAPGRPNLIADLGRGPGGLILEGHTDVVTHGSLERWTVSPYEGRIVGGRLYGRGSCDMK
GGLAAAIVAAQAVRKVLGEPSKTLRLCILCDEEGLMLGVKAFIRAGYAEGFAGAIICEPE
ENQICLWQKGAMRIWAHFQGQMAHGAMPYAGANPIPSAARFVAELGRLQSELQAESFHQH
LGKPWITPTIFQGLAGEGQFNVIPDRVRVGLDIRTNPGQDHREIEQRLQAALAASLEAGV
TAGLEVFEDRPATETPRDARIVRAVEEALALLGLPVQYGGVPGATDGTFLWAWARLPIAT
IGPGGRTVPHQADEYVELEELIAAARLYAATSVLFLADPGPLPT
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggatgcccaggacctagcccgacaggccgcccaggcggtggatgctgaagaagtg
gtgcgcctggcgcagagactggtccagatcgaaagctactaccccggccccggcgaaggg
ccggtagtggactacctcgagccctacctgcgcgagcgggggttcaagaccaccctccaa
gcggtggctccgggccgccccaacctgatcgcggacttgggccgggggccgggggggctg
atcctcgagggccacaccgacgtggtgacgcacgggagcctcgagcgctggacggtttcc
ccctacgaggggcggatcgtgggtggccggctctacgggcggggttcctgcgatatgaaa
ggagggttggcggcggcgattgtggcggcccaagcggtgagaaaagtgctgggagagccc
agcaaaaccctgcgcttgtgcatcctctgcgacgaagagggtctgatgctgggggtcaag
gcgtttatccgggctgggtacgccgaaggctttgccggggcgatcatctgcgagccggag
gagaaccagatctgcctgtggcagaagggtgcgatgcggatatgggcccacttccagggc
cagatggcgcatggggcgatgccgtatgccggggccaacccgatcccctcggcagcgcgg
ttcgtggccgagttggggcggctccaaagcgaactccaggccgagagcttccaccagcat
ctgggaaaaccctggatcacccccacgatcttccagggcctcgcaggggagggccagttt
aacgtgatccccgatcgggtaagggtaggcctggatatccgcaccaatcctggccaggat
caccgggagatcgagcagcggctgcaggcggcccttgcggccagcttggaagccggggtg
acagctgggctcgaggtctttgaggatcgcccggctaccgagaccccccgggatgcccgc
atcgtccgggcggtggaagaggccctcgccctgctgggtttgccggtgcagtacggtggg
gttccgggagctaccgacggtacattcctgtgggcctgggcccggctgcccatcgccacc
atcggccccggggggcgcaccgtgccgcatcaggccgacgaatatgtggaactcgaggag
ctcatcgccgcagcccggctgtacgctgcaaccagcgtactctttctggccgatcccgga
cctctccccacttag

DBGET integrated database retrieval system