KEGG   Meiothermus silvanus: Mesil_0169Help
Entry
Mesil_0169        CDS       T01246                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
msv  Meiothermus silvanus
Pathway
msv00010  Glycolysis / Gluconeogenesis
msv00030  Pentose phosphate pathway
msv00051  Fructose and mannose metabolism
msv00052  Galactose metabolism
msv00680  Methane metabolism
msv01100  Metabolic pathways
msv01110  Biosynthesis of secondary metabolites
msv01120  Microbial metabolism in diverse environments
msv01130  Biosynthesis of antibiotics
msv01200  Carbon metabolism
msv01230  Biosynthesis of amino acids
msv03018  RNA degradation
Module
msv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesil_0169
   00030 Pentose phosphate pathway
    Mesil_0169
   00051 Fructose and mannose metabolism
    Mesil_0169
   00052 Galactose metabolism
    Mesil_0169
  Energy metabolism
   00680 Methane metabolism
    Mesil_0169
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Mesil_0169
Enzymes [BR:msv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mesil_0169
Protein phosphatases and associated proteins [BR:msv01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mesil_0169
Messenger RNA biogenesis [BR:msv03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Mesil_0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ADH62114
UniProt: D7BGW0
Position
172564..173535
Genome map
AA seq 323 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRGGLDQGWEVFGVRQGYAGLIAGEMNSLSARDVGGI
IQQGGTMLGSARSLEFKTEEGRKVALANLEAKGIEALVVIGGNGSQTGAYALSQLGFPVV
GVASTIDNDLYGSEITIGVDTALNIALEAIDRLKTTASSHRRAFLVEVMGRDCGYLALMS
GLAGGAEVVVVPEVDTPPEEVAARLRGAYERGKAHAIAVVAEGARYGAEELMAYFREHQA
RLGFDLRSTILGHVQRGGIPGAFDRLLATRLGFGAVTRLAKGQHGILMGLLKGEISSTPL
GEVVASKKPLDASLLEMAWVLAQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcatcgcggtactcaccagcgggggcgatgcccccggaatgaacgcggccatc
cgggcggtggtgcgaggcgggctggatcagggctgggaagtcttcggggtacgccagggg
tacgccggtttgatcgcaggcgagatgaactcgctctcggcccgcgacgtgggcggcatc
atccagcagggtgggaccatgctaggcagcgcccgcagcctggaattcaagaccgaggaa
gggcgcaaggtggctttggctaacctcgaggccaaagggatcgaggcgctggtggtgatc
ggtgggaacggctcccaaaccggagcttacgccctctcgcagttgggcttcccggtggtg
ggggtggcttccaccatcgacaacgacctctacggatcagagatcaccatcggggtggac
accgccctcaacatcgccctggaagccattgaccgcttgaaaactacagcctcgagccac
cgccgggccttcttggtggaggtgatggggcgcgactgcggttatctggccctgatgtcg
gggctcgccgggggggccgaggtggtggtggttcccgaggtggataccccccctgaggag
gtcgccgcgcggctccgcggggcttacgagcggggcaaggcccacgccatcgcggtggtc
gcggagggggcccgctacggggccgaggagctgatggcttacttccgcgaacaccaggcc
cggctgggcttcgacctgcgcagtaccatcctgggccacgtccagcggggcgggatcccg
ggggcgttcgaccggttgttggccacccggctgggcttcggagcggtcacccggttggcg
aagggacagcatggcatcttaatgggtttgctcaaaggagagatcagcagcaccccctta
ggcgaggtggtggcgagcaagaagcctttggatgctagcttgctcgagatggcctgggta
ttggcccagtag

DBGET integrated database retrieval system