KEGG   Meiothermus silvanus: Mesil_0169Help
Entry
Mesil_0169        CDS       T01246                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
msv  Meiothermus silvanus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesil_0169
   01230 Biosynthesis of amino acids
    Mesil_0169
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesil_0169
   00030 Pentose phosphate pathway
    Mesil_0169
   00051 Fructose and mannose metabolism
    Mesil_0169
   00052 Galactose metabolism
    Mesil_0169
  Energy metabolism
   00680 Methane metabolism
    Mesil_0169
Enzymes [BR:msv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mesil_0169
Protein phosphatases and associated proteins [BR:msv01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mesil_0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
172564..173535
Genome map
AA seq 323 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRGGLDQGWEVFGVRQGYAGLIAGEMNSLSARDVGGI
IQQGGTMLGSARSLEFKTEEGRKVALANLEAKGIEALVVIGGNGSQTGAYALSQLGFPVV
GVASTIDNDLYGSEITIGVDTALNIALEAIDRLKTTASSHRRAFLVEVMGRDCGYLALMS
GLAGGAEVVVVPEVDTPPEEVAARLRGAYERGKAHAIAVVAEGARYGAEELMAYFREHQA
RLGFDLRSTILGHVQRGGIPGAFDRLLATRLGFGAVTRLAKGQHGILMGLLKGEISSTPL
GEVVASKKPLDASLLEMAWVLAQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcatcgcggtactcaccagcgggggcgatgcccccggaatgaacgcggccatc
cgggcggtggtgcgaggcgggctggatcagggctgggaagtcttcggggtacgccagggg
tacgccggtttgatcgcaggcgagatgaactcgctctcggcccgcgacgtgggcggcatc
atccagcagggtgggaccatgctaggcagcgcccgcagcctggaattcaagaccgaggaa
gggcgcaaggtggctttggctaacctcgaggccaaagggatcgaggcgctggtggtgatc
ggtgggaacggctcccaaaccggagcttacgccctctcgcagttgggcttcccggtggtg
ggggtggcttccaccatcgacaacgacctctacggatcagagatcaccatcggggtggac
accgccctcaacatcgccctggaagccattgaccgcttgaaaactacagcctcgagccac
cgccgggccttcttggtggaggtgatggggcgcgactgcggttatctggccctgatgtcg
gggctcgccgggggggccgaggtggtggtggttcccgaggtggataccccccctgaggag
gtcgccgcgcggctccgcggggcttacgagcggggcaaggcccacgccatcgcggtggtc
gcggagggggcccgctacggggccgaggagctgatggcttacttccgcgaacaccaggcc
cggctgggcttcgacctgcgcagtaccatcctgggccacgtccagcggggcgggatcccg
ggggcgttcgaccggttgttggccacccggctgggcttcggagcggtcacccggttggcg
aagggacagcatggcatcttaatgggtttgctcaaaggagagatcagcagcaccccctta
ggcgaggtggtggcgagcaagaagcctttggatgctagcttgctcgagatggcctgggta
ttggcccagtag

DBGET integrated database retrieval system