KEGG   Meiothermus silvanus: Mesil_0169Help
Entry
Mesil_0169        CDS       T01246                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
msv  Meiothermus silvanus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:msv01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:msv01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:msv00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:msv00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:msv00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:msv00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:msv00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
172564..173535
Genome map
AA seq 323 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRGGLDQGWEVFGVRQGYAGLIAGEMNSLSARDVGGI
IQQGGTMLGSARSLEFKTEEGRKVALANLEAKGIEALVVIGGNGSQTGAYALSQLGFPVV
GVASTIDNDLYGSEITIGVDTALNIALEAIDRLKTTASSHRRAFLVEVMGRDCGYLALMS
GLAGGAEVVVVPEVDTPPEEVAARLRGAYERGKAHAIAVVAEGARYGAEELMAYFREHQA
RLGFDLRSTILGHVQRGGIPGAFDRLLATRLGFGAVTRLAKGQHGILMGLLKGEISSTPL
GEVVASKKPLDASLLEMAWVLAQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcatcgcggtactcaccagcgggggcgatgcccccggaatgaacgcggccatc
cgggcggtggtgcgaggcgggctggatcagggctgggaagtcttcggggtacgccagggg
tacgccggtttgatcgcaggcgagatgaactcgctctcggcccgcgacgtgggcggcatc
atccagcagggtgggaccatgctaggcagcgcccgcagcctggaattcaagaccgaggaa
gggcgcaaggtggctttggctaacctcgaggccaaagggatcgaggcgctggtggtgatc
ggtgggaacggctcccaaaccggagcttacgccctctcgcagttgggcttcccggtggtg
ggggtggcttccaccatcgacaacgacctctacggatcagagatcaccatcggggtggac
accgccctcaacatcgccctggaagccattgaccgcttgaaaactacagcctcgagccac
cgccgggccttcttggtggaggtgatggggcgcgactgcggttatctggccctgatgtcg
gggctcgccgggggggccgaggtggtggtggttcccgaggtggataccccccctgaggag
gtcgccgcgcggctccgcggggcttacgagcggggcaaggcccacgccatcgcggtggtc
gcggagggggcccgctacggggccgaggagctgatggcttacttccgcgaacaccaggcc
cggctgggcttcgacctgcgcagtaccatcctgggccacgtccagcggggcgggatcccg
ggggcgttcgaccggttgttggccacccggctgggcttcggagcggtcacccggttggcg
aagggacagcatggcatcttaatgggtttgctcaaaggagagatcagcagcaccccctta
ggcgaggtggtggcgagcaagaagcctttggatgctagcttgctcgagatggcctgggta
ttggcccagtag

DBGET integrated database retrieval system