KEGG   Meiothermus silvanus: Mesil_0220Help
Entry
Mesil_0220        CDS       T01246                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
msv  Meiothermus silvanus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mesil_0220
Enzymes [BR:msv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mesil_0220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(227149..228066)
Genome map
AA seq 305 aa AA seqDB search
MPDIIVVGSINMDLVVRVQRHPLPGETLLGSDYQTFPGGKGANQAVAAARAGGSVRMIGC
LGSDSFGAQLLEGLLQDGIDTHWIKRVEGPSGVAFIVVNAQGQNSIIVAPGSNYRLLPED
LKAEVFRGAKVILLQLEVPLPTVLEAARRGKEAGTTVILNAAPARSLSADALHDVDLLVV
NEFEAGIVLEQKAPQGIEEALAAAQSLRERVSSVVITLGAEGCVWADTSGQGYVPAFQVQ
PVDTTAAGDAFVGMLASRLAKGEALAPALRWASAAGALATTQEGAQPSLPTEAEVESFLA
GRSSP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgccagacatcatcgtggtgggcagcatcaatatggatttggtggtgcgtgtacagcgt
caccccctccccggcgagaccctgctgggctcggattatcagacttttcccggtgggaaa
ggagccaaccaggcggtggcggcggcccgagcaggtggttcagtacggatgatcggatgc
ttggggagcgacagcttcggcgcacagctccttgaggggctcctccaagacgggatagat
acccattggatcaaacgtgtggagggccctagcggggtcgctttcatcgtggtgaacgcc
cagggccaaaacagcatcatcgtggcgccggggagcaactatcggctcttgccggaagac
ctgaaagccgaggtgttccggggcgcaaaggtaatccttctgcagctcgaggttcccctt
cccaccgtgctcgaggcagcccgccgaggtaaagaagcggggaccacggtgatcctgaac
gccgccccagcgcgaagcctaagcgccgatgcgcttcacgacgtggacctgctggtggtc
aacgagttcgaggcagggatcgtgctggagcaaaaagcgccccagggaatcgaggaggct
ttggcggcggcgcagagtttgcgcgagcgagtatcgagcgtggtcatcaccctgggggca
gagggctgtgtctgggcagataccagcgggcaaggctacgtcccagccttccaggtccag
ccggtagatacgacggcggccggggatgcctttgtggggatgctagccagccggttagcc
aagggcgaagccctggcacctgccctgcgttgggctagcgccgccggagccctggcgacg
acccaggagggggctcagccttcgctccccacagaggccgaagtggaaagctttctggcc
gggcgctcgagcccgtag

DBGET integrated database retrieval system