KEGG   Meiothermus silvanus: Mesil_0395Help
Entry
Mesil_0395        CDS       T01246                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
msv  Meiothermus silvanus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mesil_0395
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mesil_0395
Enzymes [BR:msv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Mesil_0395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(406368..407639)
Genome map
AA seq 423 aa AA seqDB search
MERALVVQGGIPLRGELRVNPAKNSALKIMVASLLTPEPVTLTEVPRLRDVDVMLELLSH
LGSRYAWEGHTLHLHTPEIKNTEAPRELVDKMRASFIVMGALLGRVGEAIVPMPGGCQFG
PRPVDQHLKALTRLGAEIKEENGFFHAQQTRKPSGRVVFDMPTLGGTEQALLAAALGGEA
TLVNVAQEPEIEDLCRFLQMLGVEIQGIGSSILRVQGKERLGGGSYSIIPDRIEAGTFLL
MTAATRGRITLTHVNPQHMDALLDKLAQSGHHIETGEDWVRLEATPNPLPFSVEAREYPG
FATDLQPLIAAYLATVPGTSTVADRVYPDRFGYVGELARMGADASRKEGVLLINGKTLMG
ASVKAADIRAGGALILAALAAEGESKIEGMQYVERGYEKLPARLQALGARVSFEQPALAL
AAD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtgcgctggtcgtacaaggtggaatcccgctgcggggtgaactccgggtcaac
ccggcgaagaattcggccctcaagatcatggtggcgagcctgctcacccccgaacccgtt
accctcacggaggttccgcgtctgcgcgacgtggacgtgatgctcgagcttttgtcccac
cttggcagccgctatgcctgggaaggccacaccctgcacctgcacacccctgagatcaaa
aacaccgaggctccccgcgaactggtggacaagatgcgggccagctttatcgtgatgggc
gccctactgggccgggtgggtgaggccatcgtgccgatgcccggcggttgtcagtttggc
ccccgtccggtggaccagcacctcaaagccctcacccgcctgggggccgaaatcaaggaa
gaaaacggcttcttccacgctcagcaaacccgcaagccctcggggcgggtggttttcgat
atgcccaccctgggcggcaccgaacaggcgcttttggccgcggccttgggcggggaggcc
accctggtcaacgtagcccaggaacccgagatcgaagacctgtgtcgcttcttgcagatg
ctcggggtagaaatccagggcatcggcagcagcatcctgcgggtgcagggaaaagagcgc
ctggggggaggcagctacagcatcatccccgaccgcatcgaagccggaacctttctgctg
atgaccgctgccacccggggtaggattaccctcacccacgtcaacccgcagcacatggat
gcgctcttggacaagctggcccagtccggacaccatattgaaaccggtgaagattgggtg
cggctcgaggccacccccaaccccctccccttcagcgtggaagcccgcgagtacccgggt
ttcgccaccgacctgcaaccgttgatcgccgcttacctagccaccgtgcccggcacttcc
accgtggccgaccgggtctaccccgaccgtttcggctacgtcggcgagctagcccgcatg
ggggccgatgccagccgcaaggaaggggtgcttctgatcaacggcaagaccctgatgggc
gcgagcgtcaaggccgccgatatccgtgctgggggagcgttgatcctggcggccctagcc
gccgagggcgagagcaagatcgagggcatgcagtacgtggagcgcggctacgaaaagctg
cccgcccgcctgcaagccttgggggccagggtcagtttcgagcaacccgcattggctcta
gcggcagactga

DBGET integrated database retrieval system