KEGG   Meiothermus silvanus: Mesil_0395Help
Entry
Mesil_0395        CDS       T01246                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
msv  Meiothermus silvanus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:msv00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:msv00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(406368..407639)
Genome map
AA seq 423 aa AA seqDB search
MERALVVQGGIPLRGELRVNPAKNSALKIMVASLLTPEPVTLTEVPRLRDVDVMLELLSH
LGSRYAWEGHTLHLHTPEIKNTEAPRELVDKMRASFIVMGALLGRVGEAIVPMPGGCQFG
PRPVDQHLKALTRLGAEIKEENGFFHAQQTRKPSGRVVFDMPTLGGTEQALLAAALGGEA
TLVNVAQEPEIEDLCRFLQMLGVEIQGIGSSILRVQGKERLGGGSYSIIPDRIEAGTFLL
MTAATRGRITLTHVNPQHMDALLDKLAQSGHHIETGEDWVRLEATPNPLPFSVEAREYPG
FATDLQPLIAAYLATVPGTSTVADRVYPDRFGYVGELARMGADASRKEGVLLINGKTLMG
ASVKAADIRAGGALILAALAAEGESKIEGMQYVERGYEKLPARLQALGARVSFEQPALAL
AAD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtgcgctggtcgtacaaggtggaatcccgctgcggggtgaactccgggtcaac
ccggcgaagaattcggccctcaagatcatggtggcgagcctgctcacccccgaacccgtt
accctcacggaggttccgcgtctgcgcgacgtggacgtgatgctcgagcttttgtcccac
cttggcagccgctatgcctgggaaggccacaccctgcacctgcacacccctgagatcaaa
aacaccgaggctccccgcgaactggtggacaagatgcgggccagctttatcgtgatgggc
gccctactgggccgggtgggtgaggccatcgtgccgatgcccggcggttgtcagtttggc
ccccgtccggtggaccagcacctcaaagccctcacccgcctgggggccgaaatcaaggaa
gaaaacggcttcttccacgctcagcaaacccgcaagccctcggggcgggtggttttcgat
atgcccaccctgggcggcaccgaacaggcgcttttggccgcggccttgggcggggaggcc
accctggtcaacgtagcccaggaacccgagatcgaagacctgtgtcgcttcttgcagatg
ctcggggtagaaatccagggcatcggcagcagcatcctgcgggtgcagggaaaagagcgc
ctggggggaggcagctacagcatcatccccgaccgcatcgaagccggaacctttctgctg
atgaccgctgccacccggggtaggattaccctcacccacgtcaacccgcagcacatggat
gcgctcttggacaagctggcccagtccggacaccatattgaaaccggtgaagattgggtg
cggctcgaggccacccccaaccccctccccttcagcgtggaagcccgcgagtacccgggt
ttcgccaccgacctgcaaccgttgatcgccgcttacctagccaccgtgcccggcacttcc
accgtggccgaccgggtctaccccgaccgtttcggctacgtcggcgagctagcccgcatg
ggggccgatgccagccgcaaggaaggggtgcttctgatcaacggcaagaccctgatgggc
gcgagcgtcaaggccgccgatatccgtgctgggggagcgttgatcctggcggccctagcc
gccgagggcgagagcaagatcgagggcatgcagtacgtggagcgcggctacgaaaagctg
cccgcccgcctgcaagccttgggggccagggtcagtttcgagcaacccgcattggctcta
gcggcagactga

DBGET integrated database retrieval system