KEGG   Meiothermus silvanus: Mesil_0665Help
Entry
Mesil_0665        CDS       T01246                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
msv  Meiothermus silvanus
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mesil_0665
Enzymes [BR:msv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Mesil_0665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(649562..651229)
Genome map
AA seq 555 aa AA seqDB search
MSSLTPELRQSILEHLGFLYGERAPAVLGRLEEICSGFPAQRREGGWSEKDALLITYGDQ
IHAEGEPPLQTLYDFLYERLRGVFSGVHLLPFYPSTSDDGFSVVDFQRVDPELGTWTDIR
IIAQDFRLMADLVCNHVSASSPWFQGFLQDDPQYQGFFITVDPGTDLSTVFRPRALPLLT
PFQTPSGEKLVWTTFSPDQTDLNYANPEVLLEVIEALLCYVRNGAGLIRLDAVGFIWKEI
GTSCMHLEGAHRIVKLMRLVLDAVAPHVLLVSETNAPHRENISYFGNGHDEAQLVYQFPL
PPLVMHTFRTGDASKLAGWAAGLTLPSERTTFFNFLASHDGIGVVPAGGILQPEEIAALV
RQALEHGGRVNHKDTPDGPVPYELCLTLFDALSNPNSDEAEDLKIARFLAANVILLSLQG
IPGVYIHSLFGSPSDHAGFEESGIPRRLNRHKFTKAELEERLADPASRAAKILAAYSHLL
RVRSMHPAFHPNAPQRILPSTEVLRIVRGEGDQAVGCYINVTDRPQVVSRIGKNLITGQW
FTGVLKPYQAAWIID
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcttgacccccgaacttcgccagtccatcctcgagcacctgggatttttgtac
ggggagcgggcccctgcggtgctggggcggctcgaggagatctgctcgggctttccggcg
cagcggcgggagggcggctggagcgagaaggacgccctgctcatcacctacggcgaccaa
atccacgctgagggcgagccccctctgcaaaccctgtatgactttttatacgagcggctg
cggggggttttctccggggttcacctcctgcccttttacccttccacctccgatgatggc
tttagcgtggtggacttccagcgggtggaccctgagctgggcacctggaccgatatccgc
atcatcgcccaggacttccggttgatggccgacctggtctgcaaccacgtctcagcctcc
tcgccttggttccagggcttcttgcaggatgacccccagtaccaaggatttttcattaca
gtcgatccgggcaccgacctcagtacagtattccggccccgggctctgcccctgcttacc
ccgttccagactcccagcggggagaagctggtctggacgaccttctccccggaccagacc
gacctcaactatgccaaccccgaggtgttgctcgaggtcatcgaagccctcctgtgctac
gtccgaaacggagccgggctgatccgcctggatgcggtggggttcatctggaaggagatc
gggacgagttgcatgcacctcgagggcgcccaccgcatcgtcaagctgatgcgcctagtg
ctggacgcggtagccccccacgtgctgctggtcagcgaaaccaacgcgccgcaccgcgag
aacatctcgtacttcggcaacggccacgacgaagcccaactggtctatcagttccctttg
ccaccgctggtcatgcacacttttcgtaccggggatgcctccaagctggcgggttgggcg
gcggggcttacccttccctccgagcgcaccacttttttcaacttcctggcctcgcacgat
ggaatcggggtggttccagcggggggaattttgcaaccggaagaaatcgcggccttggtg
cggcaagctttggagcatggaggccgggtcaaccacaaggacacccccgacggcccggtg
ccttacgagctgtgcctgaccctcttcgacgcactgagcaatcccaactcggacgaagcg
gaagatctcaagatcgcccgcttcctcgcggccaacgtcatcttgctcagcttgcagggg
atacctggggtctacatccacagcctcttcggctctccctcggatcacgctgggttcgag
gagagcggaatcccccgccgtctcaaccggcacaagtttacgaaggccgaactcgaggaa
cggctggccgatccggcctcgagggccgccaagatcctagccgcctactcccacctgctg
cgggtgcggtcaatgcacccggccttccatcccaatgcaccccaacggatcctgccctcc
acggaagtgctgcgcatcgttcggggtgagggagatcaggcggtcggctgttacatcaac
gtcaccgaccgcccccaggtagtgagccggatcgggaaaaacctcatcaccggacagtgg
ttcaccggggtacttaaaccgtatcaggcagcctggatcatcgattga

DBGET integrated database retrieval system