KEGG   Meiothermus silvanus: Mesil_0665Help
Entry
Mesil_0665        CDS       T01246                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K22597  glucosylglycerate phosphorylase [EC:2.4.1.352]
Organism
msv  Meiothermus silvanus
Brite
Enzymes [BR:msv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.352  glucosylglycerate phosphorylase
     Mesil_0665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: ADH62582
UniProt: D7BAR0
Position
complement(649562..651229)
Genome map
AA seq 555 aa AA seqDB search
MSSLTPELRQSILEHLGFLYGERAPAVLGRLEEICSGFPAQRREGGWSEKDALLITYGDQ
IHAEGEPPLQTLYDFLYERLRGVFSGVHLLPFYPSTSDDGFSVVDFQRVDPELGTWTDIR
IIAQDFRLMADLVCNHVSASSPWFQGFLQDDPQYQGFFITVDPGTDLSTVFRPRALPLLT
PFQTPSGEKLVWTTFSPDQTDLNYANPEVLLEVIEALLCYVRNGAGLIRLDAVGFIWKEI
GTSCMHLEGAHRIVKLMRLVLDAVAPHVLLVSETNAPHRENISYFGNGHDEAQLVYQFPL
PPLVMHTFRTGDASKLAGWAAGLTLPSERTTFFNFLASHDGIGVVPAGGILQPEEIAALV
RQALEHGGRVNHKDTPDGPVPYELCLTLFDALSNPNSDEAEDLKIARFLAANVILLSLQG
IPGVYIHSLFGSPSDHAGFEESGIPRRLNRHKFTKAELEERLADPASRAAKILAAYSHLL
RVRSMHPAFHPNAPQRILPSTEVLRIVRGEGDQAVGCYINVTDRPQVVSRIGKNLITGQW
FTGVLKPYQAAWIID
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcttgacccccgaacttcgccagtccatcctcgagcacctgggatttttgtac
ggggagcgggcccctgcggtgctggggcggctcgaggagatctgctcgggctttccggcg
cagcggcgggagggcggctggagcgagaaggacgccctgctcatcacctacggcgaccaa
atccacgctgagggcgagccccctctgcaaaccctgtatgactttttatacgagcggctg
cggggggttttctccggggttcacctcctgcccttttacccttccacctccgatgatggc
tttagcgtggtggacttccagcgggtggaccctgagctgggcacctggaccgatatccgc
atcatcgcccaggacttccggttgatggccgacctggtctgcaaccacgtctcagcctcc
tcgccttggttccagggcttcttgcaggatgacccccagtaccaaggatttttcattaca
gtcgatccgggcaccgacctcagtacagtattccggccccgggctctgcccctgcttacc
ccgttccagactcccagcggggagaagctggtctggacgaccttctccccggaccagacc
gacctcaactatgccaaccccgaggtgttgctcgaggtcatcgaagccctcctgtgctac
gtccgaaacggagccgggctgatccgcctggatgcggtggggttcatctggaaggagatc
gggacgagttgcatgcacctcgagggcgcccaccgcatcgtcaagctgatgcgcctagtg
ctggacgcggtagccccccacgtgctgctggtcagcgaaaccaacgcgccgcaccgcgag
aacatctcgtacttcggcaacggccacgacgaagcccaactggtctatcagttccctttg
ccaccgctggtcatgcacacttttcgtaccggggatgcctccaagctggcgggttgggcg
gcggggcttacccttccctccgagcgcaccacttttttcaacttcctggcctcgcacgat
ggaatcggggtggttccagcggggggaattttgcaaccggaagaaatcgcggccttggtg
cggcaagctttggagcatggaggccgggtcaaccacaaggacacccccgacggcccggtg
ccttacgagctgtgcctgaccctcttcgacgcactgagcaatcccaactcggacgaagcg
gaagatctcaagatcgcccgcttcctcgcggccaacgtcatcttgctcagcttgcagggg
atacctggggtctacatccacagcctcttcggctctccctcggatcacgctgggttcgag
gagagcggaatcccccgccgtctcaaccggcacaagtttacgaaggccgaactcgaggaa
cggctggccgatccggcctcgagggccgccaagatcctagccgcctactcccacctgctg
cgggtgcggtcaatgcacccggccttccatcccaatgcaccccaacggatcctgccctcc
acggaagtgctgcgcatcgttcggggtgagggagatcaggcggtcggctgttacatcaac
gtcaccgaccgcccccaggtagtgagccggatcgggaaaaacctcatcaccggacagtgg
ttcaccggggtacttaaaccgtatcaggcagcctggatcatcgattga

DBGET integrated database retrieval system