KEGG   Meiothermus silvanus: Mesil_0695Help
Entry
Mesil_0695        CDS       T01246                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
msv  Meiothermus silvanus
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:msv00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:msv00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
683249..684412
Genome map
AA seq 387 aa AA seqDB search
MAYEPKPEHKFTFGLWTVGNVGRDPFGLPTRPPLEPDYIVYKLAEIGAYGVNLHDNDLIP
VEATEAERERILKRFKKALQDTGLVVPMATTNLFGDPAFKDGAFTSPDARVRAYALQKTM
RAMDLGAELGAKTYVFWGGREGAEVDAGGNVLDALAHYREALNFLAEYSEDQGYGYRFAL
EPKPNEPRGDIYLPVVGAALGFIATLDKPHLFGLNPEVAHETMAGLNFVHAVAQAIDAGK
LFHIDLNDQKMGRFDQDLRFGAENLKTAFFLVKLLEDSGYDGPRHFDAHALRTEDEAGVW
EFAKGCMRTYLILKEKAERFGRDREIQDLIGAYKVQDEALARLTAKYSRENARALKGLEF
DREALGRRGPGLERLDQLTVELLLGVR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgaacccaaacccgagcacaagttcaccttcggcctgtggaccgtgggcaac
gtggggcgcgaccccttcggcctgcccacccgcccccccctcgagcccgactacatcgtc
tacaagctggccgagatcggcgcctacggggtcaacctgcacgacaacgacctcatcccc
gtcgaggccaccgaggccgagcgcgagcgcatcctcaagcgcttcaagaaggccctgcag
gacaccggcttggtggtccccatggcgacgaccaacctcttcggcgaccccgccttcaag
gacggcgccttcacctcgcccgacgcgcgggtgcgggcttatgccctccagaagaccatg
cgggccatggacctcggcgccgagctcggcgcgaagacctacgtcttctggggcgggcgc
gagggggccgaggtggacgccgggggcaacgtgctcgacgccctcgcccactaccgcgag
gcgctgaacttcctggccgagtactccgaggaccagggctacggctaccgcttcgccctc
gagcccaagcccaacgagccgcggggcgacatctacctgccggtggtgggggcagcgctg
ggcttcatcgccacgctggacaagccccacctcttcggcctcaaccccgaggtggcccac
gagaccatggcgggcctcaacttcgtgcacgcggtggcccaggccatcgacgcgggcaag
ctcttccacatcgacctcaacgaccagaagatgggccgcttcgaccaggatttgcgcttc
ggcgccgagaacctcaagacggccttcttcctggtcaagctgctggaggactccggctac
gacggcccccgccacttcgacgcccacgccctgcgcaccgaggacgaggcgggggtgtgg
gagttcgccaagggctgcatgaggacctacctcatcctcaaggagaaggccgagcgcttc
ggccgcgaccgcgagatccaggacctcatcggggcctacaaggtccaggacgaggcgctc
gcccggctcaccgcgaagtacagccgcgagaacgcccgggcgctgaaggggctcgagttc
gaccgcgaggcgctggggcggcgggggccgggcctggagcggctggaccaactcacggtg
gagctgctgctcggggtcaggtga

DBGET integrated database retrieval system