KEGG   Meiothermus silvanus: Mesil_0714Help
Entry
Mesil_0714        CDS       T01246                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
msv  Meiothermus silvanus
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:msv00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(703954..704901)
Genome map
AA seq 315 aa AA seqDB search
MKYQPAHSLESPRFAGVRTFMRLPHVRTLENVDFVVLGIPWDDATTHRPGARFGPEGIRR
VSIMLRPWNPYWNVKIFDYLSGVDYGDVPVVPGYIEDTYARIESEFEKIARSGVTPIAMG
GDHSVTLGELRGLAKVYGPLALVHIDAHLDTLDQYFGRKYNHGTPFRRAVEEGLVDPHKS
IQVGIRGSNYGPEDYQGTRDLGYELITMYELQEIGLEAALERIHRRVGQHPCFISIDIDS
VDPAYAPGTGTPEVEGFTSREIMKLVRGLRGLHFKAADVVEVLPALDPGEITAYLGGNLI
YELISLLALRKKEGG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaaataccagcctgcccattccctcgagtccccccgctttgccggggtacgcaccttt
atgcgccttccccatgtacgcaccctggagaacgtagacttcgtggtgctgggcatcccc
tgggacgatgccaccacccaccgccccggagcccgctttggccccgagggcatccgtcgg
gtctcgatcatgcttaggccctggaacccctattggaatgtgaagatcttcgattacctc
tccggggtggactatggcgacgtgccggtcgtgccgggctatatcgaggacacctacgcc
cgcatcgaatcggagttcgagaagatcgcccgatccggggtcacccccatcgccatgggc
ggcgaccactccgttaccctaggcgagctgcgcggtttggctaaggtgtatggaccgcta
gctctggtgcacattgacgcccacctggacaccctggatcagtatttcgggcgcaaatac
aaccacggcacccccttccgccgcgcggtcgaagaagggctggtggacccccacaagtcc
atccaggtgggcattcggggttccaactacggccctgaggactaccagggcacccgcgac
ctcggctacgagctcatcaccatgtacgaactccaggagatcgggctggaggctgcccta
gagcgcatccaccgccgggtaggtcagcatccgtgctttatcagcatcgacatcgactcg
gtagacccggcctatgcccccggcaccggcacccccgaggtggagggcttcaccagccgc
gagatcatgaagctggtgcgggggctacgggggttgcacttcaaagctgccgatgtggtg
gaggtgctaccggccctcgaccccggcgagatcaccgcctatttaggggggaacctgatc
tacgagttgatctcgctgctggccctgcgcaagaaggagggcggatga

DBGET integrated database retrieval system