KEGG   Meiothermus silvanus: Mesil_0878Help
Entry
Mesil_0878        CDS       T01246                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
msv  Meiothermus silvanus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(870185..870877)
Genome map
AA seq 230 aa AA seqDB search
MPSVLILHGLSSHPVLTVGPLPEVLRQAGYQIAQPTLPGHGTRPEDLKGVRWQDWYRVAL
EAYRSLPSPKAVVGLSMGGLLAAKIAAEEAPQALVAMVPALGFVNKTAYLAPYLSWAIPI
AKGTASVRDAERKAKSPNYPWMPTEAVAELVKLQREVDPLLPKVKAPALVLQARHDSTIP
EASVRRYYQRLGSAHKQYKVYDSEHDLLLDSEADKVAADIRDWLQGILPV
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcgtactcatcctgcacggtctgtcctcgcacccagtcttgacagtcggcccg
ctacctgaagtcctgcgccaagccggataccagatcgcccaacccaccctgcccgggcac
ggtacccgccccgaagacctcaagggggtacgctggcaggattggtatagggtggcgctc
gaggcgtaccgctccctccccagccctaaagcggtggtagggctttcgatgggcggcctg
ctggctgcgaagatcgccgcagaggaagctccccaagccctggtggcgatggttccggcc
ctgggcttcgtcaacaaaaccgcctacttggccccctatctctcctgggccatcccgatt
gccaagggcaccgcttcggtgagggacgccgagcgcaaggccaagagccccaactacccc
tggatgcctactgaggcggtggccgaactggtcaagcttcagcgcgaagtagaccccctt
ctgcccaaggtcaaggccccggccttggtgctacaggcccgccacgacagcaccatcccg
gaagcctcggtgcggcggtattaccagcggctaggaagtgcgcacaaacagtacaaggta
tacgacagcgagcatgacctgctccttgatagcgaggcggataaggtcgcagcggatatc
cgggactggttgcaggggatcctgccggtctag

DBGET integrated database retrieval system