KEGG   Meiothermus silvanus: Mesil_0884Help
Entry
Mesil_0884        CDS       T01246                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
msv  Meiothermus silvanus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mesil_0884
Enzymes [BR:msv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Mesil_0884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
875440..876267
Genome map
AA seq 275 aa AA seqDB search
MIERFSPAKVNLGLSVLGRRADGYHQLHTLFAALDVGDRITLEPIPQGIELRVLGADLPS
GPANLAYQAARDYLEAAGNPGGVRIVLEKHLPIAAGLGGGSGNAATVLLGLRQFYPAPVD
LLPLARNLGADVAFFLRGGLAEARGIGELLSPLEPLQVPLVLVNPGLAVSAAEAYQAMKP
DDYSPELPVASILAALKRGEEPGWWNSLEAPVFRLRPELAELKATLRAFGLRGVLMSGSG
STFFALASDLAQAQHLAARLRERFPRFWIRPAQTA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaacggttttccccggctaaggtcaacctgggcctgtcggtactgggcaggcgg
gcggatggctaccaccagctgcacaccctctttgccgcgctagatgtgggcgaccggatt
accctcgagcccatcccgcagggcatagaactccgggtcttgggggccgacttgcccagc
ggcccggcgaacctggcctaccaggcggctagagattacctagaggccgccggaaacccg
ggtggggtgcggattgttctcgagaagcacctgcccattgccgccgggctgggcgggggc
tcggggaatgcggccacagtcctgcttggcctgaggcagttctaccctgcgccggtggat
ctgctccccctagcccgaaacctaggagcagacgtagcgttcttcctgcggggggggctg
gccgaagcacgggggatcggggagctgctctcccccctcgagcccctccaggtccctctg
gtcctggtcaaccccggcctagcggtctccgccgctgaggcctaccaagccatgaagccc
gacgactatagtcccgagctacccgttgcatccatcttggcggccctcaagaggggagag
gagccagggtggtggaatagcctcgaggcccccgtcttccgcctccgccccgagctggcc
gaactcaaagcgactctgcgggctttcggactgcggggcgtgctgatgtccggttccggc
tcgaccttcttcgccctggcctcagacctagcccaagcacagcatctcgccgctcggttg
cgagaacgcttcccccgcttttggattcgcccggcccaaaccgcctaa

DBGET integrated database retrieval system