KEGG   Meiothermus silvanus: Mesil_1029Help
Entry
Mesil_1029        CDS       T01246                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
msv  Meiothermus silvanus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:msv00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1017436..1018926
Genome map
AA seq 496 aa AA seqDB search
MPYLLALDQGTTSSRAILFDLDGKVVAIEQKEFTQIYPQPGWVEHNPLEIWLTQLETAQK
VIQKAQIEPAEIAAMGITNQRETVVLWERATGQPVHNAIVWQDRRTAALCDELRARGYEP
LFRQKTGLLLDPYFSATKLAWLLDHVPGVRERAGKGELAFGTVDSWLIYNLTGGKVHATD
VSNASRTLLFNLETLQWDDHLLGILGIPKSVLPQVKPSAAHYGTVKAEWLGAEIPIAGVA
GDQQAALFGQACFEPGMAKNTYGTGCFLLMNTGRKRVESARGLLSTVAWQLEGRPAEYAL
EGSVFIAGAVVQWLRDGLGIIHNSADVEALAATVPDNGGVYLVPAFVGLGAPHWDPYARG
TIVGITRGTTKAHLARAALEAIAYQSKDVLKAMEADARLRLAELRVDGGASRNDLLMQFQ
ADILGTPVVRPKVTETTALGAAYLAGIGAGVLSEEQIRARWALEHRFEPGMAEAQRTAHY
RGWARAVERAKSWVEP
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgccctacttgttagccctcgaccagggaaccacctcgagccgggccatcctctttgac
ctggacggcaaagtggtagcgatagagcaaaaggagttcacccagatctatccgcagccg
ggctgggtcgagcacaacccgctggagatctggctcacgcagctcgagacggctcagaag
gtgatccaaaaagcccagatcgaacccgccgagatcgccgccatggggatcactaaccag
cgcgaaacggtggtgctgtgggagcgggctaccggtcagcccgtgcataatgccatcgtc
tggcaggaccgacgcacggcagccctatgtgacgaactcagggcgcgaggttatgagccc
ctgtttcgccagaagaccggtctgctcctcgatccctacttttccgcgaccaagctggct
tggttgctggatcatgtcccgggggtacgcgagcgggctgggaagggcgagctggctttt
ggcacggtggatagctggcttatctacaacctcaccggcggcaaggtgcacgctaccgat
gtatcgaacgcctcccggacgcttttgttcaacctcgagaccctccagtgggacgaccac
ttgctgggcatcttgggtatccccaagtcggtgttgccccaggtgaaaccctccgcggca
cactacggaacagtgaaggctgaatggctgggggctgagatccccatcgcgggggtagcc
ggagatcagcaggcggcgctcttcgggcaggcttgctttgagccagggatggccaaaaac
acttacggcaccggctgtttcctattgatgaataccgggcgtaagcgggtggagtcggct
cgagggctgctttccacggtggcctggcaactcgagggccgtccggccgaatacgccctc
gagggcagcgtcttcatcgccggggcggtggtgcagtggctccgtgacgggctggggatc
atccacaactccgccgacgtggaagcgttggccgctaccgtccccgataatggcggggtc
tacctggttccggccttcgtggggctgggggccccgcactgggacccctacgcgcgagga
accatcgtagggatcacccgcggcaccaccaaagcccacctggcgcgggctgccctggag
gccattgcctaccagagcaaggacgtcctcaaggcgatggaagccgatgcacggctccgg
ctggccgagctgcgggtggacggcggggcctcccgcaacgacctactgatgcagtttcag
gccgacatcttggggaccccggtagtgcgacccaaggtcaccgagaccaccgcgttaggt
gcggcttacctggccggaatcggggccggggtcttgtcggaggagcagattagggcgcgc
tgggcgctagaacatcgcttcgagccgggcatggccgaagcgcagcgcaccgcccactac
cggggctgggctcgagcggtggaacgggccaagagttgggtagagccttag

DBGET integrated database retrieval system