KEGG   Meiothermus silvanus: Mesil_1029Help
Entry
Mesil_1029        CDS       T01246                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
msv  Meiothermus silvanus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mesil_1029
Enzymes [BR:msv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Mesil_1029
Exosome [BR:msv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mesil_1029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1017436..1018926
Genome map
AA seq 496 aa AA seqDB search
MPYLLALDQGTTSSRAILFDLDGKVVAIEQKEFTQIYPQPGWVEHNPLEIWLTQLETAQK
VIQKAQIEPAEIAAMGITNQRETVVLWERATGQPVHNAIVWQDRRTAALCDELRARGYEP
LFRQKTGLLLDPYFSATKLAWLLDHVPGVRERAGKGELAFGTVDSWLIYNLTGGKVHATD
VSNASRTLLFNLETLQWDDHLLGILGIPKSVLPQVKPSAAHYGTVKAEWLGAEIPIAGVA
GDQQAALFGQACFEPGMAKNTYGTGCFLLMNTGRKRVESARGLLSTVAWQLEGRPAEYAL
EGSVFIAGAVVQWLRDGLGIIHNSADVEALAATVPDNGGVYLVPAFVGLGAPHWDPYARG
TIVGITRGTTKAHLARAALEAIAYQSKDVLKAMEADARLRLAELRVDGGASRNDLLMQFQ
ADILGTPVVRPKVTETTALGAAYLAGIGAGVLSEEQIRARWALEHRFEPGMAEAQRTAHY
RGWARAVERAKSWVEP
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgccctacttgttagccctcgaccagggaaccacctcgagccgggccatcctctttgac
ctggacggcaaagtggtagcgatagagcaaaaggagttcacccagatctatccgcagccg
ggctgggtcgagcacaacccgctggagatctggctcacgcagctcgagacggctcagaag
gtgatccaaaaagcccagatcgaacccgccgagatcgccgccatggggatcactaaccag
cgcgaaacggtggtgctgtgggagcgggctaccggtcagcccgtgcataatgccatcgtc
tggcaggaccgacgcacggcagccctatgtgacgaactcagggcgcgaggttatgagccc
ctgtttcgccagaagaccggtctgctcctcgatccctacttttccgcgaccaagctggct
tggttgctggatcatgtcccgggggtacgcgagcgggctgggaagggcgagctggctttt
ggcacggtggatagctggcttatctacaacctcaccggcggcaaggtgcacgctaccgat
gtatcgaacgcctcccggacgcttttgttcaacctcgagaccctccagtgggacgaccac
ttgctgggcatcttgggtatccccaagtcggtgttgccccaggtgaaaccctccgcggca
cactacggaacagtgaaggctgaatggctgggggctgagatccccatcgcgggggtagcc
ggagatcagcaggcggcgctcttcgggcaggcttgctttgagccagggatggccaaaaac
acttacggcaccggctgtttcctattgatgaataccgggcgtaagcgggtggagtcggct
cgagggctgctttccacggtggcctggcaactcgagggccgtccggccgaatacgccctc
gagggcagcgtcttcatcgccggggcggtggtgcagtggctccgtgacgggctggggatc
atccacaactccgccgacgtggaagcgttggccgctaccgtccccgataatggcggggtc
tacctggttccggccttcgtggggctgggggccccgcactgggacccctacgcgcgagga
accatcgtagggatcacccgcggcaccaccaaagcccacctggcgcgggctgccctggag
gccattgcctaccagagcaaggacgtcctcaaggcgatggaagccgatgcacggctccgg
ctggccgagctgcgggtggacggcggggcctcccgcaacgacctactgatgcagtttcag
gccgacatcttggggaccccggtagtgcgacccaaggtcaccgagaccaccgcgttaggt
gcggcttacctggccggaatcggggccggggtcttgtcggaggagcagattagggcgcgc
tgggcgctagaacatcgcttcgagccgggcatggccgaagcgcagcgcaccgcccactac
cggggctgggctcgagcggtggaacgggccaagagttgggtagagccttag

DBGET integrated database retrieval system