KEGG   Meiothermus silvanus: Mesil_1302Help
Entry
Mesil_1302        CDS       T01246                                 

Definition
alpha amylase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
msv  Meiothermus silvanus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mesil_1302
Enzymes [BR:msv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Mesil_1302
Exosome [BR:msv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mesil_1302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1283841..1285466)
Genome map
AA seq 541 aa AA seqDB search
MPGGRIHRPQRISTPLDGISSWSDKPITMHKDQSGTWRAEVDLPDGQHSYKFRLKSLSPF
MEGRVVEVTDPQARRIDPQNSEASVIVLRDGQDRTTAPDYPWQHDQVPLPQDDELVIYEL
HVGEFAWEGDKPGTFEGLVRRLDYLRDLGVNAVELMPVQAFPGERSWGYLPRHFFALEPG
YGTPEDFKRLVDECHARGMRVILDMVFNHSDTEAPLNHIDFYYWYRDAREGEPSYGPKFD
YERIDDTLGVRPAFRFGLEVAAFWVEEYHVDGYRLDATAVLNNFEFVQAVRDLCKEKAGG
KPFYIVAEQLPENPAIATPTGPADGAWHQAFELQVVPALCEVGEPAAALEALQPRNHGYI
SPARVVNYLESHDEHTLMRVLAEAGITGDKAFRKNKLGATLLFTAVGNPMIHQGQEFGGH
RPRDLEIRPLQWELLEHDYGLHLKEHYAFLARLRRETAALRSEDLEPLHLDAQAGVIAYR
RGGGGEVVVVANLRDADQTLTLPFPEGAWRELSFGYDLEVSSAQLSEDFPASSAKIYIRR
S
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
ttgccaggaggaaggatacaccgccctcagcgtatttccacaccccttgatggtatctcc
tcgtggagcgataagcccattacgatgcacaaggaccaaagcggcacctggcgggccgag
gtggatttgccggatgggcaacatagctacaagttccgcctgaagtcgctctcgcccttc
atggaaggccgggtggtggaggtcaccgatcctcaagctcgcaggatagacccccaaaac
agcgaggcctcagtaatcgttctccgcgatggccaagaccggaccaccgcccccgactac
ccctggcagcacgatcaggtgccgctgccccaggacgacgagttggtgatctacgagctg
cacgtgggcgagtttgcctgggagggggataagccgggcaccttcgagggcttggtaagg
cggctcgactacctgcgcgacctgggggtgaacgcggtggagctgatgccggtgcaggct
ttcccgggcgaacgctcctggggctacctaccccgccacttcttcgccctcgagcccggc
tacggcacccccgaggacttcaaacggctggtggacgagtgtcacgcgcgggggatgcgg
gttattttggacatggtcttcaaccactccgataccgaagccccgctcaaccacatcgac
ttctactactggtaccgggacgctcgcgagggagagccttcctacggccccaagtttgac
tacgagcgcatagatgacaccctgggggtgcggcccgcattccgcttcggcctcgaggtg
gcggccttctgggtggaggagtaccacgtagacggctaccgcctcgatgccaccgcggtc
ttaaacaacttcgagttcgtccaagcggtgcgcgacctatgcaaggaaaaagccgggggc
aagcctttctacatcgtagccgagcagctcccggagaacccggccatcgctacccctact
ggccctgccgatggagcttggcaccaggcgtttgagctgcaagtggtacccgccctatgc
gaggtgggcgaaccggcagccgcgctcgaggccttgcagccacgtaaccacggctatatc
tccccagcacgggtggtcaactacctcgagtcccacgacgaacacaccctgatgcgggtg
ctagccgaagccgggatcaccggggacaaggccttccgtaaaaacaaactgggagccacc
ttgctctttaccgcggtgggcaaccccatgatccaccaaggccaggaattcggtgggcac
cgcccccgcgatttggagatacggcctttgcaatgggagctgctcgagcacgactacggg
ctccacctgaaggagcactatgcctttctggcccgtctacggcgggagactgccgccctc
cgcagcgaagacctcgagcccctccacctagacgcccaggctggggtgatcgcctaccgg
cgtggcggcggaggagaagtcgtcgtggtagcaaacctgcgcgatgccgaccagaccctc
accctgcccttccctgagggggcctggcgcgagctctccttcggctacgacctcgaggtc
agcagtgcccagctcagcgaggactttccggcctcctcggcgaaaatttacatccggcgc
tcctga

DBGET integrated database retrieval system