KEGG   Meiothermus silvanus: Mesil_1319Help
Entry
Mesil_1319        CDS       T01246                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
msv  Meiothermus silvanus
Pathway
msv00230  Purine metabolism
msv01100  Metabolic pathways
Module
msv_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mesil_1319
Enzymes [BR:msv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Mesil_1319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 ATP-cone NTPase_1 PTS_IIA
Motif
Other DBs
NCBI-ProteinID: ADH63213
UniProt: D7BEH0
Position
1304366..1305040
Genome map
AA seq 224 aa AA seqDB search
MPRGNLIVMTGASGVGKGTIRARLLEYIRPLYYSISMTTRPPRPGERHGVDYYFVSRPEF
EAKIAQNGFLEYAQYVEDYYGTPREPVEKALAEGTDVLLEIEVQGALQVAQQVPEAILVF
IIPPSLSELRRRLLLRGTDSLEKIHQRLKRAEEELREAHHFDYVVVNDQLDRAVSDFSSI
IKAERLKTERMGDALERALQREPALEAELDELERKLRGNGPQGG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgccaagaggaaatctcatcgtcatgaccggggcctccggggtgggcaaaggtaccata
cgggccaggctcctagagtacatccgccccttgtactactctatctctatgaccacccgc
ccgccgcggccgggtgagcggcacggggtagattactactttgtgagcaggcccgagttt
gaggccaagatcgcccagaacggtttcttggagtacgctcagtatgtcgaggactactat
ggcactccccgcgagccggtggaaaaagccctagccgagggcactgacgtgctgctggaa
attgaagtacagggggccttacaagtggctcagcaggtccccgaggccattttggttttc
atcattcctccctccctttccgagctgcgccgccggctgctgttgcgcgggaccgatagt
ctcgagaagatccaccaacgcctcaaacgggccgaggaggaactgcgcgaggcccaccac
tttgactacgtggtggtcaacgaccaactcgaccgggcggtctcggacttctctagcatc
atcaaagccgagcgcctcaagaccgaacgcatgggggatgcgctggagcgcgcgctccag
cgcgagccagccctggaagcagagctggatgaactcgagcgcaaactgaggggcaatgga
cctcaggggggctaa

DBGET integrated database retrieval system