KEGG   Meiothermus silvanus: Mesil_1319Help
Entry
Mesil_1319        CDS       T01246                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
msv  Meiothermus silvanus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:msv00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1304366..1305040
Genome map
AA seq 224 aa AA seqDB search
MPRGNLIVMTGASGVGKGTIRARLLEYIRPLYYSISMTTRPPRPGERHGVDYYFVSRPEF
EAKIAQNGFLEYAQYVEDYYGTPREPVEKALAEGTDVLLEIEVQGALQVAQQVPEAILVF
IIPPSLSELRRRLLLRGTDSLEKIHQRLKRAEEELREAHHFDYVVVNDQLDRAVSDFSSI
IKAERLKTERMGDALERALQREPALEAELDELERKLRGNGPQGG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgccaagaggaaatctcatcgtcatgaccggggcctccggggtgggcaaaggtaccata
cgggccaggctcctagagtacatccgccccttgtactactctatctctatgaccacccgc
ccgccgcggccgggtgagcggcacggggtagattactactttgtgagcaggcccgagttt
gaggccaagatcgcccagaacggtttcttggagtacgctcagtatgtcgaggactactat
ggcactccccgcgagccggtggaaaaagccctagccgagggcactgacgtgctgctggaa
attgaagtacagggggccttacaagtggctcagcaggtccccgaggccattttggttttc
atcattcctccctccctttccgagctgcgccgccggctgctgttgcgcgggaccgatagt
ctcgagaagatccaccaacgcctcaaacgggccgaggaggaactgcgcgaggcccaccac
tttgactacgtggtggtcaacgaccaactcgaccgggcggtctcggacttctctagcatc
atcaaagccgagcgcctcaagaccgaacgcatgggggatgcgctggagcgcgcgctccag
cgcgagccagccctggaagcagagctggatgaactcgagcgcaaactgaggggcaatgga
cctcaggggggctaa

DBGET integrated database retrieval system