KEGG   Meiothermus silvanus: Mesil_1433Help
Entry
Mesil_1433        CDS       T01246                                 

Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
msv  Meiothermus silvanus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesil_1433
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mesil_1433
   00630 Glyoxylate and dicarboxylate metabolism
    Mesil_1433
Enzymes [BR:msv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Mesil_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1428783..1430348)
Genome map
AA seq 521 aa AA seqDB search
MKGIEIRGPEVPALKEILTPHALAFVAGLQREFGAVRKGLLQRRAEVAARIRAGEKPNFL
EHTRFIREGNWKVAPAPADLNDRRVEITGPVERKMMINALNSGAKVFMADCEDALSPTWE
NIVQGQQNLIDAVRRTIRFTSPEGKEYRLAEKTATLVVRPRGWHLTERHVLVDGEPVSGS
LFDFGLYFFHNAHELLERGSGPYFYLPKLENHLEARLWNDVFNFAQDYMGIPRGTIRATV
LIETILAAFEMEEILYELKDHAAGLNAGRWDYIFSCIKKFATEDVIFPDRAQITMTVPFM
RAYTELLVRTCHKRGAHAIGGMAAFIPSRKDPEVNARAIAAVTKDKERESGDGFDGTWVA
HPDLVPVALSVFDKVLGDKPHQKDRLREDVDLTVRPEQLIDFHVPGGTVTEAGARNNISV
SLQYTAAWLGGSGAVAIFNLMEDAATAEISRAQLWQWLHKGARLEDGRIFTEELYRQLKA
EEMKKLEGLNNLEAAAALLDELVLQPEFREFLTLPAYERLG
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtatcgaaatccggggcccggaagtcccggcgctgaaggagattctgaccccc
cacgctctggcttttgtggccgggctacagcgcgagtttggcgcggtgcgcaagggattg
ttgcagcgccgggcggaggttgccgcacggatcagggcgggggaaaagccaaacttcctc
gagcacacccgcttcatccgcgaggggaactggaaagtagccccggcccctgccgacctc
aacgatcgccgggtggagatcaccgggcccgtcgagcgcaagatgatgatcaacgcgctc
aactcgggggccaaggtcttcatggccgactgcgaggatgccctctcccccacttgggag
aacatagttcaagggcagcaaaacctcatagacgcagtgcgccgcaccatccgcttcacc
agcccagagggcaaagagtaccgcctggccgagaagaccgccaccctggtggtgcgccca
cgcggctggcacctcaccgagcgccacgtgctggtagatggtgagccggtctcgggatcg
ctcttcgacttcgggctgtacttcttccacaacgcccacgaactgctcgagcgtggctcg
ggcccctacttctacctgcccaagctggaaaaccacctcgaggcccgcctgtggaacgat
gtattcaacttcgcccaggactatatgggcatcccgcgcggcaccatccgcgccaccgtg
ctcatcgagaccatcctggcggctttcgagatggaagagattctctacgaactcaaagac
cacgctgccgggctcaacgcggggcgctgggattacatctttagctgcatcaagaaattc
gccaccgaggacgtgatcttccccgaccgggcccagatcaccatgaccgtgcccttcatg
cgggcctacaccgaactgctggtgcgcacctgccataagcgcggcgcccacgccatcggg
ggcatggccgccttcattcccagccgcaaggaccccgaggtaaacgcccgcgctatcgcc
gcggtgaccaaggacaaagagcgcgaatccggcgacggcttcgacgggacctgggtggcc
caccccgacctagtaccggtcgcgctgagcgtgttcgataaagtcttgggcgacaaaccc
catcagaaagaccgcctgcgcgaagacgtggacctcacggtgcggcccgagcagctcatc
gacttccacgtgcccggcggcaccgtcaccgaggcaggagcgcgcaacaacatcagcgta
agcttgcagtataccgccgcctggctgggcggctcgggcgcggtggcgatcttcaacctg
atggaagacgccgccaccgccgagatttcccgcgcccagctgtggcagtggctccacaag
ggggccaggctcgaggatggccgcatcttcaccgaggagctttaccggcagctcaaagcc
gaggagatgaaaaaactcgagggcctgaacaacctcgaggccgctgctgcgctactggac
gaattggtgctgcagccggagttccgcgagtttttgaccctgcctgcgtacgagcggttg
ggctag

DBGET integrated database retrieval system