KEGG   Meiothermus silvanus: Mesil_1436Help
Entry
Mesil_1436        CDS       T01246                                 

Definition
succinate dehydrogenase membrane subunit SdhD
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
msv  Meiothermus silvanus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesil_1436
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mesil_1436
   00650 Butanoate metabolism
    Mesil_1436
  Energy metabolism
   00190 Oxidative phosphorylation
    Mesil_1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1431604..1431996
Genome map
AA seq 130 aa AA seqDB search
MAIRARRYQDAKAQAGTNLELAWWVFMRLSGLVLVFLVLGHIYMNFVLIDVNTINYDYVA
RRLSNTTWKIYDLVILGLALLHGLNGSRYVMDDWIKDPSRRFITKAVVYSLGVLVFLIGS
ISLLNHDFSR
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggctatccgcgctcgtcgttatcaggatgctaaagcgcaagccggaaccaacctcgag
ctggcctggtgggtattcatgcgcctttcggggttggtgctggtgtttttggtgctcggg
cacatctacatgaacttcgtgctcatcgacgtgaataccatcaactatgactatgtggcc
cggcgattatccaatactacgtggaagatttacgacctggtgatcttgggcctggccttg
ctccatgggctaaatggctcccgctacgtgatggacgactggatcaaagaccccagccga
cgtttcatcaccaaagcggttgtctacagcctgggggtgctggtcttcctgattgggagc
atctcgctcctcaatcacgacttctcgaggtaa

DBGET integrated database retrieval system