KEGG   Meiothermus silvanus: Mesil_1468Help
Entry
Mesil_1468        CDS       T01246                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
msv  Meiothermus silvanus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mesil_1468
Enzymes [BR:msv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Mesil_1468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1464927..1466429
Genome map
AA seq 500 aa AA seqDB search
MDIPRSFGILLHPTSFPGRWGIGTLGAEARRFVDWLASTGAHWWQVLPLGPTSYGDSPYQ
SFSAFAGNPYLIDPDILIEKGWLEPEEPPAYPPHKVDYGWLYVTRWDLLRRAYDGFVGRG
KPEDLEAFARYRQQEADWLEDYALFMALKHSFGGRPWNEWTAPLRRREPAALEQARKEYA
DEIGFHAWTQWVFFQQWGDLRNYAHARGIKLIGDMPIFLAYDSSDVWANPQYFYLDAEGL
PTVVAGVPPDYFSETGQLWGNPLYRWEVMQAEGFGWWIHRIKKSLEACELVRIDHFRGFE
AYWEVPFGEPTAVKGRWVKAPGKELFQAVRAALGDAAIIAEDLGVITPEVEELRDSNGFP
GMKILQFAFSDETNPFLPHNYPESGNVIVYTGTHDNDTTIGWYQTAPKEELAFMDKYLEQ
YGLKIEKPEDAPWVLAELGFRSRAKLVILPLQDVLRLGPEARMNFPGTLGNNWSWRYAPG
DLTPELALHLRELARSSDRL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggatataccgcgttcgtttgggatcctcctacaccccacgagctttcccggccgctgg
ggaatcggcaccttgggtgctgaagcccggcggtttgtggattggctggcttctaccggg
gcccactggtggcaggtattgcccctagggcctaccagctacggcgactcaccctaccag
tctttctcggccttcgccggaaacccctacttgattgacccggatatcctcatagagaag
ggttggctcgagcccgaggaaccccccgcctacccaccccacaaggtggactacggctgg
ctctatgtcacccgctgggatctgctgcggcgggcctacgatggctttgtggggcggggg
aaaccggaggacctcgaggccttcgcccgctaccgccagcaggaggcggattggctcgag
gactatgccttattcatggccctcaagcactccttcgggggccggccctggaacgagtgg
accgctcctttgcgcaggcgcgaacccgcggcgctcgagcaagcccgcaaagagtacgcc
gacgagataggtttccacgcctggacccagtgggttttcttccagcaatggggggatttg
cgcaactatgcacacgcgcggggcatcaagctgatcggagatatgcccattttcctggcc
tatgactcctccgatgtgtgggccaacccgcagtatttctatcttgacgccgaagggctc
cccacggtggtggctggggttccgccggattacttctccgagaccgggcagctttggggt
aacccgctctaccgctgggaggtgatgcaggccgaggggtttggctggtggattcaccgc
atcaagaagtcgctcgaggcctgcgaattggtgcgcatcgaccattttcgcggctttgag
gcatactgggaagttcccttcggtgagcctaccgcggtcaaggggcggtgggtcaaggct
cccggcaaggaactgtttcaggcggtgcgcgcggccttgggcgatgcggcgatcatcgcg
gaggatttaggggtgatcaccccggaggtggaggaactccgcgattccaatggcttcccg
ggcatgaagatacttcagtttgctttctctgacgagaccaacccgttcttaccgcataac
taccccgagtccggaaatgtgatcgtctacaccggcacccacgacaacgacaccaccatc
ggctggtaccagaccgcccccaaggaagaactcgcgttcatggacaagtacctcgagcag
tatggcttgaagatcgaaaaacccgaggacgccccttgggtgctggccgaactgggcttc
cgctcgagggccaagctggtgattctgcccttgcaggacgtgctgcgtttgggccccgag
gcccgtatgaacttccccggaacgctgggcaacaactggagttggcgctatgccccgggg
gaccttaccccagagttggcactgcacttgcgggaactggcccgctccagcgaccgcttg
taa

DBGET integrated database retrieval system