KEGG   Meiothermus silvanus: Mesil_1587Help
Entry
Mesil_1587        CDS       T01246                                 

Definition
(GenBank) transcriptional regulator, IclR family
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
msv  Meiothermus silvanus
Pathway
msv00010  Glycolysis / Gluconeogenesis
msv00620  Pyruvate metabolism
msv00640  Propanoate metabolism
msv00680  Methane metabolism
msv01100  Metabolic pathways
msv01110  Biosynthesis of secondary metabolites
msv01120  Microbial metabolism in diverse environments
msv01130  Biosynthesis of antibiotics
msv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesil_1587
   00620 Pyruvate metabolism
    Mesil_1587
   00640 Propanoate metabolism
    Mesil_1587
  Energy metabolism
   00680 Methane metabolism
    Mesil_1587
Enzymes [BR:msv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mesil_1587
Lipid biosynthesis proteins [BR:msv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mesil_1587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding IclR ACAS_N AMP-binding_C HTH_IclR TrmB MarR_2 HTH_23 HTH_24 Rrf2 HTH_29 HTH_17
Motif
Other DBs
NCBI-ProteinID: ADH63474
UniProt: D7BFC1
Position
complement(1584990..1587497)
Genome map
AA seq 835 aa AA seqDB search
MGRSKRLSTVEAALRVLAYLAAHPEGLEAREVARMLGKSLSTAYALLASLVAEGFAEREG
SSYRVSKAALAPAHSTPKAEHFERLQDALEELYLRTRERVYLALLTPEGGLELATRGRQG
LPKPEGLERQVQGSLYAFALGKAVLAYLPEDELTQQAGELRPRTPYTLTDPLALREELAR
VRQMGFAVELEEYALGLSGLAAPIFGSEGQVIGSLGVVVPSRRFPYAFTRLLRAVQEVSQ
ASAHQVGPTQPRREPPSLESAPLPSPSKTPDHTPESPQVWADPTLRHAANLQDYRGTYQR
SLEDPEGFWAEWAERFCWFERWRKVQELNLPLHRWFVGGKTNLTYNALDRHASSPRRNQL
ALVALSGEGKTHKLTYRELLDRTARLASALKRLGVVAGDRVAVYMPTGLEASLAMLACAR
IGAVHVLIPAGLGAAALRERLEDTGAKLLIAADRSYQAGQAVSLSGVVEEAVQGLEVEVL
WHRRGNTPRHPEFWEVLEAESTLAPAEPLDSEHPLFILYTSGSTGKPKGVVHVHGGYMVG
TTYHLRTFFDAKDTDVFWSTSDIGWIVGHSYIVYAPLLEGLTSVLREGAPDYPNPGIFWQ
LVERYRVNVMFTAPTAVRMFMKFGPEWPSKADLSSLRLLAVAGEPLNPEAWLWAWEHLAD
SGRRAFVADNWWQTELGGPTLGTPLTHPAKPGAAGVALPGVEAAIVSPEGQEVPAGQGGL
LVLKRPFPHMMRTVWGNPERYAQYWREIPGEVYAAGDVASCDEDGYFSVLGRADDVLNVA
GHRIGTADVESALVSHPAVAEAAVIGVADSLKGERIKAFVVLRAGQLQSEALVDA
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgggacggagcaagcggcttagcacagtggaagcagccctgcgggtactggcctatctg
gccgcccatccggagggactcgaggcgagggaggtagcccggatgctgggcaagagtctc
tcaacggcctacgccctgctggccagcctggtcgcggagggcttcgccgagcgggagggg
tctagctaccgggtctccaaggccgccttggcccccgcccactccacccccaaagccgag
cacttcgagcgcttgcaggatgcgctcgaggagctttacctgcgcacccgggagcgggtc
tacctggctttgctcaccccggagggaggacttgaactggccacccgcggccgccagggg
ctgcccaagcccgaggggctggagaggcaagtccaggggagcttgtacgccttcgcgctg
ggaaaagcagtcttggcctatctgccggaggacgaactcacccagcaggcgggggagttg
cgcccacgtaccccctacacccttaccgatcctctagccttgcgcgaggagctggcgcgg
gtgcgacagatgggcttcgcggtggaactcgaggaatacgccttgggcctctctgggctg
gctgcgcccatctttggctcagaagggcaggtgatcggctcgctaggggtggtggtgcct
tcacgtcggttcccctacgcctttacccgactgctccgggcggtacaggaggtgagccag
gccagcgcgcaccaggtcgggccgacccagcccagacgtgaacccccatcgctcgagagc
gctccgctgccctcaccctcgaaaacccccgaccacacgcccgaatcgccccaggtgtgg
gccgatcccacactccgtcatgcggcaaacctgcaagattaccgcggcacctaccagcgc
agtctagaggaccccgaggggttctgggcggagtgggctgagcgcttctgttggtttgag
cggtggaggaaagtccaggagctgaacctgccccttcatcgctggttcgtcggcgggaaa
accaacctgacctataacgccctcgaccgccacgcctcgagcccgcggcgtaaccaactg
gcgctggtggcgctttcgggagagggcaaaacccacaagctcacctaccgcgagctgctg
gaccgaaccgctcggttagcctcggccttaaagcggctaggggtggtggcgggagatcga
gtagccgtgtatatgcccaccgggctcgaggcctctttggccatgctggcgtgtgcccgc
atcggggccgtgcatgtgctgatcccggcaggattgggggcagctgctttgcgcgagcgc
ttagaggataccggggctaagctcttgatcgcggcagaccggtcttaccaagccggacag
gccgtgtcgctgagcggggtggtcgaggaagcggtgcaggggctcgaggtcgaggtgtta
tggcaccgccggggcaacacgccccggcaccccgagttctgggaggtgctcgaggccgag
agcaccttggcccccgccgagccgctggacagcgaacaccccctgtttatcctctacacc
tcgggctccaccggcaagcccaagggggtcgtccacgtccacggcgggtacatggtgggc
accacctaccacctgcgcaccttctttgacgccaaggatactgacgtgttctggagtacc
tcggacatcggctggatcgtggggcactcctatattgtctacgctccgctgctcgaaggt
ctcaccagcgtgctgcgcgagggggctcccgactaccccaatccaggtattttttggcag
ttggtcgagcgctaccgggtcaacgtgatgttcaccgcgcccactgcggtgcggatgttt
atgaagtttggcccggaatggccgagcaaggccgacctctcgagcctacgcctgctggcc
gtggcgggagaacccctcaatcccgaggcctggctgtgggcctgggaacacctagccgac
tcgggacggcgggctttcgtggcggataactggtggcagaccgaactcggcggtcccacc
ttgggaacccccctcactcacccggccaagccgggagcggcgggcgtggcgttgccgggg
gtagaagcagccatcgtcagccctgagggccaggaggtcccggcggggcagggcgggcta
ctcgtgctcaaacggcccttcccccacatgatgcgcaccgtatggggtaaccctgaacgc
tacgcccagtactggcgcgagatccccggcgaagtctacgctgcgggggatgtagcgagt
tgcgacgaagacggctacttcagcgtcttaggccgtgccgacgatgtactcaacgtggcc
gggcaccgcatcggaaccgcggacgtggagagcgccttggtctcccaccctgcagtcgcc
gaggccgcggtgatcggggtggcggattccttgaaaggcgagcgcatcaaagcctttgta
gtgctcagggctgggcagctccaaagcgaagccctggtagacgcttag

DBGET integrated database retrieval system