KEGG   Meiothermus silvanus: Mesil_1706Help
Entry
Mesil_1706        CDS       T01246                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
msv  Meiothermus silvanus
Pathway
msv03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:msv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mesil_1706
Enzymes [BR:msv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Mesil_1706
DNA repair and recombination proteins [BR:msv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Mesil_1706
    RecFOR pathway proteins
     Mesil_1706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N RuvA_C HHH_5
Motif
Other DBs
NCBI-ProteinID: ADH63589
UniProt: D7BFN6
Position
complement(1714830..1715411)
Genome map
AA seq 193 aa AA seqDB search
MVRYLKGTALRKTENSVILLVGGFGLEVFCPTTTLTHLPEEGEIALHTKLVVREDDLSLY
GFADQRSLELFEMLLGVSGVGPKVGLNLLSSLSPALLARALADGDIRLLTGAQGVGRKLA
ERIALELRGKVPPHLMGEAGPILRRPQTEEAELALVTLGFRENQVRSAVAQIVQQNPEAS
TQEIIRLALKALR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggtccgctatctcaaaggcaccgcgctacgcaaaaccgaaaacagcgtgattttgctg
gtgggagggttcgggctcgaggtcttctgccctactactacccttacccacctgcccgaa
gagggagagatcgccctgcacaccaagctcgtcgtacgcgaggacgacctctcgctgtat
ggcttcgccgaccaacgctcgctggaactcttcgaaatgctgctgggggtgagcggggtg
ggacccaaggtggggctcaatctgctctcctcgttatcgccagctttgctggcacgcgca
cttgccgatggagatattcgcctgcttaccggagcgcagggggtagggcgaaagctggcc
gagcgcatcgcgctcgagcttcgcgggaaagtcccgccccacctgatgggcgaggctggc
cccatcctccgccgcccccagaccgaagaagccgagctggccctggtcacgctgggcttc
cgcgagaaccaagtacgttccgccgtggcccagatcgtccaacaaaatcccgaagccagc
actcaggagatcatccggctagccctcaaagcgctgcgttaa

DBGET integrated database retrieval system