KEGG   Meiothermus silvanus: Mesil_1709Help
Entry
Mesil_1709        CDS       T01246                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
msv  Meiothermus silvanus
Pathway
msv00071  Fatty acid degradation
msv00280  Valine, leucine and isoleucine degradation
msv00281  Geraniol degradation
msv00310  Lysine degradation
msv00360  Phenylalanine metabolism
msv00362  Benzoate degradation
msv00380  Tryptophan metabolism
msv00410  beta-Alanine metabolism
msv00627  Aminobenzoate degradation
msv00640  Propanoate metabolism
msv00650  Butanoate metabolism
msv00903  Limonene and pinene degradation
msv01100  Metabolic pathways
msv01110  Biosynthesis of secondary metabolites
msv01120  Microbial metabolism in diverse environments
msv01130  Biosynthesis of antibiotics
msv01212  Fatty acid metabolism
Module
msv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mesil_1709
   00650 Butanoate metabolism
    Mesil_1709
  Lipid metabolism
   00071 Fatty acid degradation
    Mesil_1709
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mesil_1709
   00310 Lysine degradation
    Mesil_1709
   00360 Phenylalanine metabolism
    Mesil_1709
   00380 Tryptophan metabolism
    Mesil_1709
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mesil_1709
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mesil_1709
   00281 Geraniol degradation
    Mesil_1709
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mesil_1709
   00627 Aminobenzoate degradation
    Mesil_1709
   00930 Caprolactam degradation
    Mesil_1709
Enzymes [BR:msv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mesil_1709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ADH63592
UniProt: D7BFN9
Position
complement(1716690..1717460)
Genome map
AA seq 256 aa AA seqDB search
MYENILLETHGKVGLIRLNRPKQLNAINTATLSEIARAVSEFEHHDAIGAMVLTGNERAF
AAGADIAEFQQTSLAELLRGLRAEQYEVLRRAKKPLIAAVSGFAYGGGCELAMMCDLIVA
SETARFAQPEINLGIIPGAGGTQRLTRQIGKYWAMETVLAGRILSAWEAYRMGLVNRVVP
IELYLEEALELGNLIASRAPLAAQLAKDAVNRAQDLPLEHGLAYERSQFLIAFGSEDKQE
GTTAFIEKRKPVWRGR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaaaatatcctcctcgaaacccacggcaaagttgggctgatccgcctcaaccga
cccaaacagctcaacgcgatcaataccgcaaccctcagcgagatcgcccgagcggtgagc
gagttcgagcaccacgatgcaatcggggccatggtcctcaccggtaacgagcgggccttc
gccgccggagcggacatcgccgagttccagcaaacctcgctcgcagaactcttacggggt
ctgcgggccgagcagtacgaggtactgcggcgtgctaaaaagccgttgatcgcggcggtc
tcggggtttgcctatggcggtggctgtgagctggctatgatgtgcgacctgatcgtagcc
tcagagacggcccggttcgcccagcccgagatcaacctgggcattatccccggcgcgggt
ggaacccagcgccttacccggcagatcggcaagtattgggccatggagaccgtactggcc
gggcggattttgagcgcctgggaagcttaccgtatgggactggtaaacagggtggttccc
atcgaactttacctcgaggaagccctcgagctaggcaacctgatcgcctcccgcgctcct
ttggccgcccaactcgctaaagatgccgtcaaccgcgcccaagatctcccgctcgaacac
ggcctagcctacgagcgcagccagttcctgatcgcctttggcagcgaggacaagcaggag
ggaaccaccgcttttatcgagaaacgcaagccggtgtggagaggaaggtga

DBGET integrated database retrieval system