KEGG   Meiothermus silvanus: Mesil_1838Help
Entry
Mesil_1838        CDS       T01246                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
msv  Meiothermus silvanus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mesil_1838
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mesil_1838
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mesil_1838
Enzymes [BR:msv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mesil_1838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1827150..1828403
Genome map
AA seq 417 aa AA seqDB search
MNLPEYPLPDTRGRFGPYGGRYVPETLIPALEELTEAYVHFKHDPDFLQEYEYYLRHYVG
RPSPLYYAANLTHHFGGARIYLKREDLNHTGAHKINNTLGQALLCKRMGKKRVIAETGAG
QHGVSVATVAALLGLECVVYQGSEDVRRQALNVFRMKLLGAEVRPVESGTKTLKDATNEA
IRDWVTNVRDTFYIIGSVVGPHPYPMMARDFQSVVGEEVKAQLREREGKSVPDAVVACVG
GGSNAIGVFAPFAYLPQPERPRLIGVEAAGHGLGSGAHSASIGAGRRGVLHGAMMYLLYD
EDGQIQPAHSVSAGLDYPGVGPEHSYYADAGVAEYVSVDDDEALEGFKLLSRLEGILPAL
ESAHAIAYAAKLAPEMRPEQVIVINLSGRGDKDVVEVMRVLEERRAQNAKRPTRGGL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaacctacctgaataccccctgcccgacacccgggggcgcttcggcccctacggtggg
cgctatgtaccggagaccctaatcccggctttggaagaactcactgaggcgtatgtgcac
ttcaagcatgatccggacttcctgcaggagtacgagtactacctgcggcactatgttggc
cgtccctctcccttgtactatgccgctaacctcacccaccacttcggtggagccaggatc
tacctaaagcgtgaggacttgaaccacactggagcgcacaagatcaacaacaccttgggc
caagccctcttgtgcaaacgcatgggcaaaaagcgggtcatcgctgagaccggggcgggc
cagcatggggtcagcgtggcgacggtggcggctttgttgggcctcgagtgcgtggtctat
caggggtccgaggacgtgcgccgccaggcgttgaacgtctttcgcatgaagctgttgggg
gccgaggtgcggccggtggaatcgggtaccaagaccctcaaagacgccaccaacgaggcc
attcgggactgggtgaccaacgtgcgggacaccttttacatcatcggctcggtggtgggg
ccgcatccttatcccatgatggcccgcgactttcaatcggtcgttggggaagaggtcaaa
gcccagttgcgggaaagggagggaaagtctgtccccgatgcggtagtggcttgtgtggga
ggtggctcaaacgccattggggtgttcgctcccttcgcgtacctgccccaacccgaacgg
ccccggctcatcggggtagaagccgccgggcatggccttggctccggggcgcactcggcc
agcatcggggccgggcggcgcggggtgctgcatggagcgatgatgtacctgctctacgac
gaggatgggcagatccagccggcccactcggtctcggcaggcctcgattacccgggggtg
ggacccgagcactcctactacgccgatgcgggggtggccgagtacgtttccgtagatgac
gatgaggcgctcgaggggttcaagttgctttcgcggctggagggcattctgcctgcgctc
gagtccgcccacgccattgcctacgcggccaagctggctccggagatgcgcccagaacaa
gttatcgttatcaacctctcagggcggggagataaggatgtggtagaggtgatgcgggtg
ttggaggaacgtcgggcgcaaaacgccaaacgccctacgcggggaggattatga

DBGET integrated database retrieval system