KEGG   Meiothermus silvanus: Mesil_1839Help
Entry
Mesil_1839        CDS       T01246                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
msv  Meiothermus silvanus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mesil_1839
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mesil_1839
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mesil_1839
Enzymes [BR:msv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mesil_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1828400..1829191
Genome map
AA seq 263 aa AA seqDB search
MTTHEAFMRALFQGRAALIPYATAGYPDRSGFSRMVEQLLPYADLLEIGLPYSDPLGDGP
VIQRASETALRNGTTVRKVLEMVHEVRAQTDKPIYLMTYLNPVIATGPERFFHEFAQAGV
TGLILPDLPPDEDPELVDLAHAAGLSTTFLLAPTSTDARIAAVAPYCTGFVYTVSVTGVT
GVRDRLPDGLPELVGRIRQHTQVPTAIGFGISSEATARQAALAADGVVVASALIRAVEEG
RALEPVLEDIRRGLQKHSVPWPG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccacgaagctttcatgcgagcgcttttccaaggccgggcggcgctaattccc
tacgctacggcaggctatcccgaccgcagcgggtttagccggatggtagaacagttattg
ccctatgccgatttgctcgaaatcggcctgccctattccgaccccctgggcgatggcccg
gtgattcaacgggcctctgagacggcgctcagaaacggcacgaccgtacgcaaggtgctg
gagatggtgcacgaggtacgtgcccagaccgacaaacccatatacctgatgacctacctc
aacccggttatcgccaccggccccgagcgcttcttccatgagttcgcccaggccggggtc
accggcctgatcctgcctgatcttccccccgacgaggatcctgagctggtagatctggcc
cacgcggcgggtctttccaccacctttttgctagcccccacctctaccgatgcccgcatc
gccgccgtagccccctactgtactggctttgtatacaccgtttcggtgaccggggtgacc
ggggtacgggatcggctgcccgacgggctacccgagctggtaggccgcattcgccagcac
acccaggttcctaccgccatcggtttcggcatctcgagcgaggctacggcgcgccaggct
gccctagccgccgacggagtggtggtggcgagcgccctgatccgggcagtggaagagggt
agagcgctggagccggttctagaggatatacgacggggtttgcaaaaacattctgtcccc
tggccggggtaa

DBGET integrated database retrieval system