KEGG   Meiothermus silvanus: Mesil_1839Help
Entry
Mesil_1839        CDS       T01246                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
msv  Meiothermus silvanus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mesil_1839
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mesil_1839
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mesil_1839
Enzymes [BR:msv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mesil_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1828400..1829191
Genome map
AA seq 263 aa AA seqDB search
MTTHEAFMRALFQGRAALIPYATAGYPDRSGFSRMVEQLLPYADLLEIGLPYSDPLGDGP
VIQRASETALRNGTTVRKVLEMVHEVRAQTDKPIYLMTYLNPVIATGPERFFHEFAQAGV
TGLILPDLPPDEDPELVDLAHAAGLSTTFLLAPTSTDARIAAVAPYCTGFVYTVSVTGVT
GVRDRLPDGLPELVGRIRQHTQVPTAIGFGISSEATARQAALAADGVVVASALIRAVEEG
RALEPVLEDIRRGLQKHSVPWPG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccacgaagctttcatgcgagcgcttttccaaggccgggcggcgctaattccc
tacgctacggcaggctatcccgaccgcagcgggtttagccggatggtagaacagttattg
ccctatgccgatttgctcgaaatcggcctgccctattccgaccccctgggcgatggcccg
gtgattcaacgggcctctgagacggcgctcagaaacggcacgaccgtacgcaaggtgctg
gagatggtgcacgaggtacgtgcccagaccgacaaacccatatacctgatgacctacctc
aacccggttatcgccaccggccccgagcgcttcttccatgagttcgcccaggccggggtc
accggcctgatcctgcctgatcttccccccgacgaggatcctgagctggtagatctggcc
cacgcggcgggtctttccaccacctttttgctagcccccacctctaccgatgcccgcatc
gccgccgtagccccctactgtactggctttgtatacaccgtttcggtgaccggggtgacc
ggggtacgggatcggctgcccgacgggctacccgagctggtaggccgcattcgccagcac
acccaggttcctaccgccatcggtttcggcatctcgagcgaggctacggcgcgccaggct
gccctagccgccgacggagtggtggtggcgagcgccctgatccgggcagtggaagagggt
agagcgctggagccggttctagaggatatacgacggggtttgcaaaaacattctgtcccc
tggccggggtaa

DBGET integrated database retrieval system