KEGG   Meiothermus silvanus: Mesil_1944Help
Entry
Mesil_1944        CDS       T01246                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
msv  Meiothermus silvanus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesil_1944
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mesil_1944
  Amino acid metabolism
   00310 Lysine degradation
    Mesil_1944
Enzymes [BR:msv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mesil_1944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1926961..1928229
Genome map
AA seq 422 aa AA seqDB search
MATELKVPAVGESIVEVEIGQWLKKEGDPIKRDEALVELVTDKATLELPSPVDGVLGKIL
KKAGEIAAVGETVAMLETVVGKGEAPASAESSSQATATQPPAPQASSGAEPGSQVKAPAA
GKVVAEPRTMPAAERVMAQTGLTPAQVEPSGPGGRILKEDVQRAAQAAPAPAPQPVHSTP
APAISQPTGERRDDVVPMTPIRRRIAERLLAAKQNTAMLTTFNEADMGAVMELRKEYGEA
FQKKYGVKLGFMSFFVKAAVQALQEIPQLNAEIQGTNIVYHRYYDIGIAVGGGEGLVVVI
VRDADKKSMAQIEAEIADMAERVKTKRIKPEELMGGTFTITNGGIYGSLNSTPILNSPQV
GILGMHAIVERPVVRGGQIVIRPMMNLAMSYDHRIVDGREAVTFLKRIKELIENPVRLAL
EV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgaactcaaggttcccgcggtgggtgaatccatcgtggaggtggagattggc
cagtggctgaagaaagagggtgaccctatcaaacgggatgaggccctggtggagttggtt
acggacaaggcgaccttagaactgcccagtccggtagacggagtattgggtaagatcctc
aaaaaagctggggaaatcgctgcggtaggagagacggtggcaatgctcgagacggtggtt
ggtaagggagaggctcctgccagtgccgaatcttcttcccaagctacggcgacccagccc
cccgctccccaggcgtccagtggggctgaacccggcagccaggtcaaggcccctgccgcc
gggaaggtggttgcggagcctcgtaccatgcccgctgctgagcgggtgatggctcagacc
ggccttaccccggcgcaagtcgagccttctggccccggcgggagaatcctcaaggaagac
gtccagcgggctgcacaagccgctcccgccccggctccccaaccggttcactctaccccg
gccccggccatctcccaaccgaccggtgaacgccgcgacgacgtggtgcccatgactcct
atccgccgccgcatcgccgagcggttgttggctgcgaagcaaaacaccgccatgctcacc
accttcaacgaggccgacatgggagcggtgatggagctgcgcaaggagtatggcgaggct
ttccagaagaaatacggcgtcaagctcggcttcatgagctttttcgtcaaggcggcggtg
caggctttacaggagatcccccagctcaacgccgagatccagggtaccaacattgtttac
caccgctactacgacatcggcattgcagtaggtggtggcgaagggttggtggtggtgatc
gtgcgcgacgccgacaagaagagcatggcccagattgaggccgagatcgccgacatggcc
gagcgggtcaaaaccaagcggatcaagccagaggagctgatgggcggaaccttcaccatc
accaacggtggaatctacggctccttgaactcgacccccatcctcaattccccgcaggtc
gggatcctggggatgcatgccattgtggaacggccggtggtacgcggcggccagattgtg
atccgcccgatgatgaacctggcgatgagctatgaccaccgtattgtggacgggcgcgag
gccgttaccttcctcaagcggatcaaggaattgatcgagaatccggtgaggttggcgcta
gaagtgtag

DBGET integrated database retrieval system