KEGG   Meiothermus silvanus: Mesil_2060Help
Entry
Mesil_2060        CDS       T01246                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
msv  Meiothermus silvanus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesil_2060
   01230 Biosynthesis of amino acids
    Mesil_2060
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesil_2060
   00051 Fructose and mannose metabolism
    Mesil_2060
   00562 Inositol phosphate metabolism
    Mesil_2060
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mesil_2060
Enzymes [BR:msv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mesil_2060
Exosome [BR:msv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mesil_2060
  Exosomal proteins of bladder cancer cells
   Mesil_2060
  Exosomal proteins of melanoma cells
   Mesil_2060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2064393..2065145
Genome map
AA seq 250 aa AA seqDB search
MRRTLVAGNWKMHKTPTEAKAWFQELLRRMPPVSAEPALMVPFTALAAAQEILAGTGVAY
GAQDVSAHLEGAYTGEVSARMLEDLGCTYTIVGHSERRQYHGESDTLVAQKAKRLLEHSI
TPILCVGEPIAAREAGNAVAYTLSQLEGSLEGVEPGSPDRLVIAYEPVWAIGTGKTATPQ
DAEAMHGEIRSWLAGRYSPGFAEGVRVLYGGSVKPDNAAALFRQPNIDGGLVGGASLQLD
DYLKLLEAAR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagaaccttggttgcaggcaactggaaaatgcacaaaacccccaccgaggccaag
gcctggttccaagagctgctccgccggatgcccccagtctcggctgaacccgcgctgatg
gtcccgtttaccgcgcttgcggcggcgcaggaaatccttgcgggcacgggcgtggcctac
ggggctcaggatgtctcagcccacctcgagggcgcctacaccggggaggtctcggcccgg
atgctcgaggatctgggctgcacctacaccatcgtcggccactccgagcggcggcagtac
cacggagaatccgacactttggtggcgcagaaggccaagcgtttgctcgagcacagcatc
acccccattctctgcgtgggcgagcccatcgcggcacgcgaagcgggcaacgcggtggcc
tacacgctctcccagctcgagggcagcctggagggagtcgagccgggctcccccgatcgc
ttggtcatcgcttacgagccggtctgggccatcgggacgggaaagaccgctacccctcag
gatgccgaggctatgcacggggagatccgaagctggctagccgggcgctacagtcccggg
tttgccgagggggtgcgggtgctctacgggggctcggtcaagccggacaatgccgcggcc
cttttccgccagcccaacatcgacggcgggcttgtaggcggggcgagtctgcaactcgac
gattacctaaagctgctcgaggccgccaggtaa

DBGET integrated database retrieval system