KEGG   Meiothermus silvanus: Mesil_2155Help
Entry
Mesil_2155        CDS       T01246                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
msv  Meiothermus silvanus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mesil_2155
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mesil_2155
Enzymes [BR:msv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mesil_2155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2171354..2172136)
Genome map
AA seq 260 aa AA seqDB search
MRWAHVPGVLGEIVRRRWEEVLPLVGSPLPEPPTVPSFGGALAEPGLSLIAEVKRKSPSQ
GDIAQLDPAQVARQYAEGGARAISVLTEPHYFAGSDQDLRKVRGAVNLPLLRKDFTVHPY
QLAEARSLGASAALLIVAVLREETASFLEAAHQAGIEALVEVHDEAELEIALEAGATILG
INNRDLTTLEINLETAPRLGRLARQRGYSGLLVAESGYGRKEEIVPLEGLFDAVLVGTSL
ARSGSWRQAVEVLMGRGIFS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgggctcacgtaccgggagttttaggggagatcgttcggcggcgatgggaggaa
gtgcttcccctggtcggctcgccattgcccgaaccgcccacggttccctcattcggtggg
gcgctggctgagcctggcttgtccttgatcgctgaggtcaaacgcaaaagcccctcccag
ggggatatcgcccaactcgacccggcccaggtcgcccgccagtacgccgagggtggggct
cgggccatcagcgtactgaccgagcctcactactttgcgggttccgaccaggacttgcgg
aaggtgcggggggcagtgaacttgcccctcttgcgcaaagacttcaccgtgcatccctat
caactcgctgaggcccgcagccttggggcctcggcggcgctgctgatcgtggcggtattg
cgcgaagagaccgcaagtttcctcgaggccgcccaccaggccggaatagaggccttggta
gaggtgcacgacgaggccgaactggaaattgccctggaggcgggcgcgaccatcttgggc
atcaacaaccgcgacctcaccaccctcgagatcaacctcgagaccgccccccgcctaggc
cggctagcccggcagcgcggatactcgggcctcttggtggccgagtcggggtatgggcgc
aaagaagaaatcgttccactggaggggcttttcgacgcggtgctggtgggaaccagcctg
gcccgtagcggcagctggcgccaagccgtcgaggttctgatgggccgagggatattttcg
tag

DBGET integrated database retrieval system