KEGG   Meiothermus silvanus: Mesil_2178Help
Entry
Mesil_2178        CDS       T01246                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
msv  Meiothermus silvanus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesil_2178
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mesil_2178
   00640 Propanoate metabolism
    Mesil_2178
   00660 C5-Branched dibasic acid metabolism
    Mesil_2178
Enzymes [BR:msv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mesil_2178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2194598..2195761
Genome map
AA seq 387 aa AA seqDB search
MNLHEYQAKELLARYGIPVPPGKVAYTADEAKQIATEYGNTVVIKAQVHTGGRGKAGGVK
LAKTPEEAREKASQILGLNIKGFVTRKVLVAKAVDIAKEYYAGLILDRVTQRVVLMLSKE
GGVDIEEVAATKPYAIIKHPIDPHKGLRPFEARELIKKAGMEGNLNKLASVLVQLYNAYV
GIDASIAEINPLVITPAGDVVAADAKIVLDDNALYRHPDLSTLREVDAEHPLEVEASNYG
FSYVKLDGWIGVIGNGAGLVMYTLDLVNRVGGKAANFLDIGGGAKADVVYNALKVVLKDP
DVKGVFINIFGGITRADEVAKGVIRAMDEGILTKPVAMRVAGTAEEEAKALLKGRPIYMY
PTSIEAAKAIVSMTGGGASAHSTGGAQ
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgaacttacacgagtaccaagccaaagaactcttggcccgctacggcatcccggtgccg
ccagggaaggttgcttacaccgccgacgaggccaagcagatcgccaccgagtatggcaac
acggtggtgatcaaagcccaggtgcataccggcggacgcggcaaagccgggggagtcaag
ctcgccaaaacccccgaggaagcccgcgagaaagccagccagatcctggggctcaacatc
aaaggcttcgtaacccgcaaagtgctggtagctaaggcggtggacatcgccaaggagtac
tatgcggggctgatcctggatcgggtgacccagcgggtggtgttgatgctgtccaaggaa
ggcggggtagacatcgaagaggtggctgctaccaagccctacgcgattatcaagcacccc
attgacccgcataaaggtctacgccctttcgaggcccgtgaactcatcaaaaaagcgggc
atggagggcaacctcaacaaactggcgagcgtcctggtacagctgtataacgcctacgtg
ggcatcgatgcctccattgccgagatcaaccccctggtcatcacccctgctggggatgtg
gtagccgccgacgccaagattgtgctcgatgataacgctctgtaccgccaccccgacctc
tccaccttgcgcgaggtggacgccgagcacccgctcgaggtcgaggcttctaactacggc
ttctcttacgtcaagttagatggctggataggggtgattggcaacggggcggggctggtg
atgtataccctggacctggtgaaccgggtgggcggtaaggccgcaaacttcctcgacatc
ggcggaggggctaaggccgacgtggtctacaacgcgctcaaggtagtgctcaaagacccc
gacgtgaagggggtctttatcaacatcttcggcgggatcacccgcgccgacgaggtcgcc
aagggtgtgatccgggccatggacgaaggtatcctgaccaaaccggtggcaatgcgggta
gccggaaccgctgaggaagaagccaaggccctactcaaaggccgtcctatttacatgtat
ccgacctccatcgaagccgccaaagccatcgtctcgatgaccggcggtggcgcttccgcg
cactctacgggaggtgcccaatga

DBGET integrated database retrieval system