KEGG   Meiothermus silvanus: Mesil_2290Help
Entry
Mesil_2290        CDS       T01246                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
msv  Meiothermus silvanus
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mesil_2290
Enzymes [BR:msv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Mesil_2290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2320261..2321199)
Genome map
AA seq 312 aa AA seqDB search
MRSSELPFTGPATFLKAPYRPLLEPWTADVGFLGLPYDFAVGYRPGARFAPNALREASGR
YAPGSEGYFDLETETYRLGGLSLVDAGDVDPAQLEYTETFRRITEAARTLRKRVRLPVFV
GGDHSVSYPILKAYDDLEELYVVQLDAHLDFSDSRNGTQYSNSSPFRRAAEDVPGLKHIT
AIGLRGLRTNPEAYRAAKARGHTLVTAARVREDLSWVLDQLPQGQKVYLSFDVDVLDPSI
MPGTSSPEVEGLTYAEALAVVRRTITRNELVGFDLVELAPNWDSSGLSSLVGARLLAEVL
CDWCSGADLFGP
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcagcgagttgcccttcaccggccccgccaccttcctcaaagccccctaccgc
cccctcttggagccttggactgccgacgtgggctttttgggcctgccctacgactttgcg
gtgggctaccgccccggcgcccgcttcgcgccgaacgctctgcgagaggccagcggccgc
tacgcccccggctccgagggctacttcgacctcgagaccgaaacctaccgcctggggggc
ctgagcctggtggacgcgggcgacgtggatccggcccagctcgagtacaccgagaccttc
cgccgcattaccgaggccgcccgcaccctcaggaagcgggtgcggctgccggtctttgtg
gggggcgatcactcggtcagctatccgatcctcaaggcctacgacgacctcgaggagctg
tacgtagtccagctcgacgcccatctggacttctcagatagccgtaacgggacccagtac
tccaacagtagccccttccgccgcgctgccgaggacgtgccgggcctgaagcacatcacc
gccattggcctgcggggcctgcgcaccaaccccgaggcctaccgagcggccaaggccagg
ggccacaccctcgtcaccgccgccagggtgcgcgaagatctgtcctgggtgctggaccag
ctaccgcagggccaaaaggtgtacctcagcttcgatgtggacgtgctcgacccctcgata
atgcccggaaccagcagcccggaggtggaggggttgacctacgctgaggccctagcggta
gtgcggaggactatcacgcgcaatgagctggtgggctttgatctggtcgagcttgcgccg
aattgggactcgagcgggcttagttcgctggtaggagcgcggctcttggcggaggtgttg
tgcgactggtgctcaggtgctgacctgttcggcccgtag

DBGET integrated database retrieval system