KEGG   Meiothermus silvanus: Mesil_2365Help
Entry
Mesil_2365        CDS       T01246                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
msv  Meiothermus silvanus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:msv01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:msv00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2393402..2394670)
Genome map
AA seq 422 aa AA seqDB search
MIHLSDQVRERFARRKPFLEDEAALARVRQILQEIEHEGDAALDRWSERLDGFPAEEIPK
RAWREAYDDLNSELRDALETSRERIEAFYVNEPRGGFLEASPEGLLGQLVRPLERVGVYV
PGGSAPLISSVLMAAVVARVAGVGEVVVASPPRVPPAILAAAWVAGADRLFAMGGAQAIA
ALAYGTGRVPRVDKIVGPGNRYVILAKREVYGAVGIEALPGPTETLIVADASADARLLAA
DLLAQAEHGPDSEAWLLSPDPDLLARVEAELHSQLATLPRAEIARKALERSGLVRVGSLE
EALELANLYAPEHLCLSVEDPTRWLGRVQNAGGVFLGEHSCEALGDYIAGPSHVMPTAGT
ARFGGGLAVRDFLKIIPVVGLSSEAVAKLAPLGAQLAREEGLEAHARALDLRAHNGSRGD
ER
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgatccatctgtccgatcaggttcgcgagcgatttgctcgtagaaagccttttctcgaa
gacgaggcagcactcgcacgggttcggcaaatcctgcaggagatcgaacacgagggggat
gccgccttggatcgctggagtgagcgattggatggctttcccgccgaagagatccccaag
cgagcttggcgggaagcttatgatgacctaaatagtgaacttagggatgccctcgagact
tcccgtgagcggatcgaggcgttttatgtcaatgaaccccgcggcggcttcttggaggct
agccctgagggtttattaggtcagctggtgcggcctctggagcgggtgggggtgtacgtc
cccggtgggagtgctcccctcatctcctcggtgctgatggcggcggtggtggcacgggtg
gccggagtgggcgaggtggtggtggcgagcccccctcgggttcctccagccatcctggcg
gcggcctgggtagcgggggccgaccggctctttgccatgggcggtgcccaggccatcgcg
gctttggcctatggcaccgggcgggttccgcgggtggataagatcgtcggaccgggcaac
cgctacgtgattctggctaagcgagaagtctacggggcggtaggaatcgaggccctgccc
ggccctacggagaccctgatcgtagccgacgcttcagcggatgcccggctgctggctgcc
gacctcttggcccaagcggaacacggccccgattccgaggcttggttgctctcacccgat
cctgacctactggcccgggtcgaagccgaactccacagccagctcgccaccctcccccga
gccgagatagcccgcaaggccctcgagaggagcgggttggtccgggtggggagcttggaa
gaagcgctcgagctggccaacctctatgctcccgagcatctttgtctctcggtggaggat
cccacccgctggctggggagggtgcaaaacgccggaggggtgttcctcggcgagcactcc
tgcgaggccttgggggattacatagccgggcctagccacgtgatgcccaccgcgggcacg
gcccgctttggaggggggctggcggtgcgggactttctcaagataatcccggtggtaggg
ctttcctccgaggcagtagccaagctagctccgctgggggcccagttggcgcgggaagag
gggctcgaggcccacgcgcgggcccttgatctgcgggcgcataacggtagccggggcgat
gagcgatga

DBGET integrated database retrieval system