KEGG   Meiothermus silvanus: Mesil_2394Help
Entry
Mesil_2394        CDS       T01246                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
msv  Meiothermus silvanus
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:msv00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2425590..2427527
Genome map
AA seq 645 aa AA seqDB search
MLGVCYYPEHWPRDRWAEDARRMRECGLSYVRIGEFSWSRLEPEPGRFDFEWLDQAIATL
HAEGLQVVLGTPTPTPPKWLVDRHPDILATDREGRLRKFGSRRHYSFSSRTYQAHTRRIV
TVIAQRYGNHPAVAGWQTDNEYGCHDTTRSYGPEDLLAFREWLRAKYGSIEALNAAWGNV
FWSMEYRTFEEIDLPNLTVTEANPAHWLDFYRFSSDQVAAYNKLQVEIIRQYSPGRFITH
NFMGYTPDFDHFKVAEDLDVASWDSYPLGFTDMDVLPVSEEEKLRYARTGHPDIPAFHHD
LYRGVKPRWWVMEQQPGPVNWAAHNPSPAPGMVRLWTWEALAHGAEVVSYFRWRQFPQAQ
EQKHAGLNRPDFQPDVGYWEAQQVARELEGLELPPTQQAPVALVFDYEADWVTRIQPQGR
EFTYRDLVWNFYQALRSLGLDVDFVKPGGSLEGYRLGVVPCSPILHEATIRALHNTQAQL
VFGPRTGSKTESMGIPPNLPPGKLAEWLPIRVTRVESLRPGVNFALEWNGQRYTSSVWKE
WVESDLAPVAKFDDGRGALWQHDNLHYLAFWPTVAFLRAYLGHLANRQGLQTFSLSEGLR
LRRRGHLTFAFNYGPHEQQAPASPQARFVLGGRMVPPHGLSIWES
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgcttggagtctgctactaccccgaacactggccccgcgaccgctgggccgaggacgcc
cgccggatgcgggaatgcggccttagctacgtacgcatcggtgagttttcctggagccga
ctcgagcccgaaccgggtcgcttcgatttcgagtggctggaccaggccatcgcgaccctt
cacgccgaaggcctccaggtagtgctgggaacacccactcccaccccgcctaagtggctg
gtggaccgacaccccgacatcctggcgacagaccgcgagggccgcttgcgcaagtttggc
tcgaggcgtcactacagcttttcgagccgaacctaccaagcacatacccgccgcatcgtg
accgtcatagcccagcgctacggtaaccaccccgcagtagcgggctggcagaccgataac
gagtacggctgccacgacaccacccgcagctatggcccagaggatttgttggccttccgc
gagtggctgagggctaaatacggctcgatcgaagcgctgaatgcagcctggggcaacgtc
ttctggagcatggagtaccgcaccttcgaggagattgacctacccaacctcaccgtcacc
gaggctaacccggcgcactggctcgacttctaccgcttcagctcggatcaggtggcggct
tacaacaagctacaggtcgaaatcatccgccagtattcgccggggcggtttatcacccat
aacttcatgggctatacccccgacttcgaccacttcaaagtagcagaggacctcgacgta
gccagctgggacagctacccgctgggctttaccgatatggacgttttaccggtctccgaa
gaggaaaagctccgctacgcccgcaccggccaccccgacatcccggcctttcaccacgac
ctctaccgcggggtgaagccgcgctggtgggtgatggaacagcagccggggccggtgaac
tgggcggcccataacccttctcctgcccccggcatggtgcggctatggacctgggaagcg
ctggcccacggagccgaagtggtgagctatttccgctggcggcaattcccccaggcccag
gaacagaagcatgccgggctcaaccgccccgacttccaacccgacgtgggctactgggaa
gcccagcaggtcgcgcgggagctggaagggctcgagctgccccctacccaacaagccccg
gtggcgttggtcttcgactacgaggccgactgggtaacgcgcatccagccgcagggccgc
gagttcacctaccgcgacctggtctggaacttctatcaggccctgcgctctcttggcctg
gatgtggacttcgtgaagccaggggggagcctcgaggggtaccggctcggggtagtcccc
tgctccccgatcctgcatgaggccacgatccgggctttgcacaatacccaggcccagctg
gtcttcgggccacgtacgggctctaagaccgaatccatgggtatccctccaaacctcccc
cccggcaagctggccgaatggctgcccatccgggtaacccgagtcgaatcgctgcgccca
ggggtgaacttcgccctcgagtggaacgggcagcgctacacctcttcggtgtggaaggag
tgggtcgagtccgatctcgcgcccgtcgccaagttcgacgatggccgaggggctctctgg
cagcacgataacctgcactacctggctttctggcccacggtggcttttctccgggcctat
ctgggccacctggccaaccgccaaggcctgcaaactttctcgctttccgagggcttgagg
ctacggcggcggggccacctgaccttcgccttcaactatggcccacacgaacagcaagct
ccggcctccccgcaggcccgcttcgtgttggggggccgtatggtcccgccgcacggcctg
agcatctgggagagctaa

DBGET integrated database retrieval system