KEGG   Meiothermus silvanus: Mesil_2670Help
Entry
Mesil_2670        CDS       T01246                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
msv  Meiothermus silvanus
Pathway
msv00330  Arginine and proline metabolism
msv00332  Carbapenem biosynthesis
msv01100  Metabolic pathways
msv01130  Biosynthesis of antibiotics
msv01230  Biosynthesis of amino acids
Module
msv_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mesil_2670
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Mesil_2670
Enzymes [BR:msv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Mesil_2670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA AAA_30
Motif
Other DBs
NCBI-ProteinID: ADH64517
UniProt: D7BBQ5
Position
2710821..2711972
Genome map
AA seq 383 aa AA seqDB search
MRAERPLLDSRSYRRVVVKVGSAVLSGAAGRARQLAIAEQIAALKAEGRQVVLVSSGAVA
SGMAKLGLKERPKTMPGKQAAAAVGQPVLMQLWEQAFAWYDLRVGQVLLTAEDLAHRHRY
LNARHTLETLLEWNVVPIINENDTVMIDEIKFGDNDQLSALIASLVGADLLLVLSDIDAL
YDADPRMNPTASPVRYVERVDAEVMRMAGDTPGHAGTGGMRSKLLAAKKAQDAGIPMLLL
PGEDPRSITRALQGEPVGTFFAGGNKRYSGRRLWLYQLPKPAGEIVVDAGAARALRQGGA
SLLPAGIREVRGNFGVGEAVRCLDAGGELIGVGLVNYSSAEIERIKGAKTKDIERILGYN
HSDEVIHRDHFALAGELSPSDGS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccgagcgcccccttttggactcgaggagctatcgccgggtggtggtcaaagtc
ggcagcgcggtattgagcggggctgccgggcgggcccggcagctggcgattgccgagcag
atcgcggccctcaaagccgaggggcgtcaggtagtgctggtgtcctcgggggcggtagcg
agtggaatggctaagctcgggctcaaggagcgccccaagaccatgcccggcaaacaagcc
gccgccgcggtggggcagccggtactgatgcagctgtgggagcaagccttcgcctggtat
gacctgcgggtagggcaggtcttgctcaccgccgaagatctagcccaccgccaccgctat
ctgaacgcccggcacaccctcgagaccctgctggagtggaatgtggtccctatcatcaac
gaaaacgacacggtgatgatagatgagatcaagtttggcgacaacgaccagctctcggct
ctgatcgcctccttggtgggggccgatcttttgctggtgctttccgatatcgatgcgctc
tacgacgcggatccacggatgaacccaaccgctagtccagtgcgctatgtcgagcgggtg
gatgccgaggtgatgcggatggcgggggatacgccgggccacgcaggcaccggaggtatg
agaagcaagctgctagccgcgaaaaaggcgcaagatgcgggaattcccatgctgcttttg
ccgggagaggatccccgtagcatcacccgggcgctgcaaggcgaaccggtgggtactttc
tttgctgggggcaataaacgctatagcgggcggagactttggctttaccaattgcccaaa
cccgctggggagattgtagtggacgccggggcggcgcgagctttgcgtcagggcggggcc
tcgctgttacccgctgggatccgggaggtgcgcgggaattttggggtaggcgaagcggtg
cgctgcctagatgcaggaggggagctcatcggagtagggctggtgaattactcttcggca
gagatcgagcggatcaagggggccaagaccaaggacatcgagagaatcctgggctataac
cactccgacgaggtgatccaccgtgaccacttcgccctcgcaggcgagctgagtccgtcc
gatgggtcgtag

DBGET integrated database retrieval system