KEGG   Meiothermus silvanus: Mesil_2787Help
Entry
Mesil_2787        CDS       T01246                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
msv  Meiothermus silvanus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesil_2787
   01230 Biosynthesis of amino acids
    Mesil_2787
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesil_2787
  Energy metabolism
   00680 Methane metabolism
    Mesil_2787
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mesil_2787
Enzymes [BR:msv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Mesil_2787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2827688..2828350
Genome map
AA seq 220 aa AA seqDB search
MRELWLVRHGETTWNAEGRHQGQLNVPLSPRGVGQTFRLAERLRASGVVFDKLYSSDLER
AQETARPIAQALDMPIYLDPRIREVNSGRLQGLLQSEIEAHFPDYVRAVRADPWNTPRPQ
GESMAEVSRRVEAFLRELPSGRFLIVTHGGVIRAALKLALNLDGDTWRRFRIQNTSITRL
AFPEGAVASFREEGYAITVGDAAHLERWAEALTTDEVEAG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaactctggctggtccgacacggggagaccacctggaacgccgaggggcggcac
caggggcagctcaacgtgccgctctcgccccggggggtggggcaaaccttccgcctagcc
gagcgcctgcgcgccagtggggtggtattcgacaagctgtatagctccgacctcgagcgg
gcccaggagaccgcccggcccatcgcccaggccctggatatgcccatctacctcgaccca
cgcatccgcgaggtcaactccgggcggctgcaaggactgctgcaaagcgaaatcgaagcg
cacttccccgactacgtgcgggccgtacgggccgacccctggaacacccctcgcccccag
ggggaaagcatggccgaggtgagccgccgggtcgaggccttcttgcgcgaactgccctcg
ggccggtttctgatcgtgacccacggcggggtgatccgagcggcgctcaagctggcgctg
aacctggatggcgatacctggcggcgcttccgtatccaaaacacctcgatcacccggctg
gcctttcccgaaggggccgtggcgtcttttcgcgaggagggctatgccatcacggtaggg
gacgccgcccacctcgagcgctgggctgaagcccttaccaccgacgaggtagaagctggc
taa

DBGET integrated database retrieval system