KEGG   Meiothermus silvanus: Mesil_2787Help
Entry
Mesil_2787        CDS       T01246                                 

Definition
(GenBank) Phosphoglycerate mutase
Organism
msv  Meiothermus silvanus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2827688..2828350
Genome map
AA seq 220 aa AA seqDB search
MRELWLVRHGETTWNAEGRHQGQLNVPLSPRGVGQTFRLAERLRASGVVFDKLYSSDLER
AQETARPIAQALDMPIYLDPRIREVNSGRLQGLLQSEIEAHFPDYVRAVRADPWNTPRPQ
GESMAEVSRRVEAFLRELPSGRFLIVTHGGVIRAALKLALNLDGDTWRRFRIQNTSITRL
AFPEGAVASFREEGYAITVGDAAHLERWAEALTTDEVEAG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaactctggctggtccgacacggggagaccacctggaacgccgaggggcggcac
caggggcagctcaacgtgccgctctcgccccggggggtggggcaaaccttccgcctagcc
gagcgcctgcgcgccagtggggtggtattcgacaagctgtatagctccgacctcgagcgg
gcccaggagaccgcccggcccatcgcccaggccctggatatgcccatctacctcgaccca
cgcatccgcgaggtcaactccgggcggctgcaaggactgctgcaaagcgaaatcgaagcg
cacttccccgactacgtgcgggccgtacgggccgacccctggaacacccctcgcccccag
ggggaaagcatggccgaggtgagccgccgggtcgaggccttcttgcgcgaactgccctcg
ggccggtttctgatcgtgacccacggcggggtgatccgagcggcgctcaagctggcgctg
aacctggatggcgatacctggcggcgcttccgtatccaaaacacctcgatcacccggctg
gcctttcccgaaggggccgtggcgtcttttcgcgaggagggctatgccatcacggtaggg
gacgccgcccacctcgagcgctgggctgaagcccttaccaccgacgaggtagaagctggc
taa

DBGET integrated database retrieval system