KEGG   Meiothermus silvanus: Mesil_2932Help
Entry
Mesil_2932        CDS       T01246                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
msv  Meiothermus silvanus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mesil_2932
Enzymes [BR:msv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Mesil_2932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2975050..2975655
Genome map
AA seq 201 aa AA seqDB search
MKRMIEVEDTGLVFPCETDVDRLASLGREWLEIIGENPEREGLRKTPERMAKAWAFLTRG
YCQNLEEIINGAIFQGEGSEMVVVKGIEFYSMCEHHLLPFFGKVHIGYIPNGKILGLSKF
GRITDMFARRLQVQERLAAQIADAIVEVLEPQGVGVVIEGVHLCMMMRGVEKQHSSTTTS
AVRGVFRDDPRTREEFMSLIH
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcatgatcgaagtcgaagacacgggcttggtcttcccctgcgaaaccgatgtg
gatcgcctggcctctctgggccgggagtggctcgagatcatcggggagaaccctgagcgc
gaggggctgcgcaagacccccgaacgcatggcgaaagcctgggcgttcttgacccggggc
tactgccagaacctcgaggagattatcaatggagcgatctttcagggggagggcagtgag
atggtggtggtcaaggggatcgagttttactcgatgtgcgagcatcacctgctgcccttc
ttcggcaaggtgcatatcggctatatccctaatgggaagatcctggggctttccaagttt
ggtcgcatcaccgatatgtttgcccgccgcctgcaggtgcaagaacggctggctgcccag
atcgccgatgccatcgtggaggtgctcgagcctcaaggggtaggcgtggtgatcgaaggg
gtccacctgtgcatgatgatgcgcggggtagagaaacagcactcgagcactactaccagc
gcggtaaggggggtcttccgcgatgaccccaggacccgcgaggagttcatgagcctgatc
cactga

DBGET integrated database retrieval system