KEGG   Meiothermus silvanus: Mesil_2986Help
Entry
Mesil_2986        CDS       T01246                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
msv  Meiothermus silvanus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mesil_2986
Enzymes [BR:msv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mesil_2986
Exosome [BR:msv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mesil_2986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3033456..3034502
Genome map
AA seq 348 aa AA seqDB search
MKTHSKEPPIASTPGPALPPLPYRPRRLRQSAALRDSVAETRLHPEDLIAPFFVIPGQGR
EEPVHALPGIARYSVDLLLPQLERSLKLGVRSVMLFGVLPPSEKDPLAQSAADPGGPVPT
ALRAARKAFGNDLVLYADVCLCTHTDHGHCGLLKETPRGVVIDNDASLVQLARMALTQAE
AGVDCVAPSDMMDGRVGYLRRALDEAGHTGVGILSYAVKYASAFYGPFREAAGSAPSFGD
RSTYQMDPRNAREALREARLDEEEGADLLMVKPALAYLDILARLRPTTQLPLVAYNVSGE
YAMLKAAAAAGVLEEGRAVRETLTAIKRAGADLIITYHALEALERGWL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaagacccattccaaagaaccaccgatcgcttcgacccccgggccagctctgccgcct
ctaccctatcggccccggcggctgcgccaaagcgccgccttgcgcgacagtgtggccgag
acccggctccacccggaagatctgatcgcgccattcttcgtgatcccaggccaagggcgc
gaggagccggttcatgccctaccgggaatcgcgcgttacagcgtggatttgctgctaccc
cagctcgagcgctccctcaagctgggggtgcgctcggtaatgctcttcggggtgctgccc
ccgagcgaaaaagacccgctggcccaaagcgccgccgacccgggcggcccggttcctacc
gctttgcgtgccgcccgaaaagccttcggcaacgacctggtgctctacgccgatgtatgc
ctttgcacccacaccgaccacgggcactgcgggctactcaaggagacgcctaggggcgtg
gtgatcgacaacgacgcgagcttggtccaactggcccggatggcgctaacccaggccgag
gccggggtggactgcgtggccccctcggacatgatggacgggcgggtaggctacctgcgc
cgggcgctggatgaagccgggcacaccggggtgggcatcctctcctacgcggtaaagtac
gccagcgccttctacggccccttccgcgaggccgccgggagcgcccccagcttcggcgac
cgcagcacctaccagatggacccccgcaacgcccgcgaggccttgcgcgaagcccggctg
gacgaggaagaaggggccgatttgctgatggtaaagcccgccctggcttatctggacatc
ctagcccggctccggcccaccacccagctgccactggtagcctacaacgtaagcggggag
tacgccatgctcaaagcagcggcggcagcaggggtgctcgaggagggccgggccgtgcgc
gaaaccctcaccgcgatcaaacgggccggagcggacctcatcatcacctaccacgcccta
gaggcgctcgagcgcggttggctgtga

DBGET integrated database retrieval system