KEGG   Meiothermus silvanus: Mesil_2992Help
Entry
Mesil_2992        CDS       T01246                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
msv  Meiothermus silvanus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:msv00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3039422..3040804
Genome map
AA seq 460 aa AA seqDB search
MSRLVVIGGGMAGLSAAYAAHKANPALTITLLEAGPRLGGKVLTHAEDGFLLEGGPDAVV
RYKPWALELMRELGLEGELVGTLPARPSALIHDGKRALPIPAGLQMVVPGDLWALAKTPL
LSPFGKARALLDLLLPGKEEDEAFGEFIRRRLGNQVWERLAAPLSGGIYGGDPAELSTLA
AFPQLKELERTHSSLIRGALEQRKKRGTREAGGLFASLRGGLGTWVEAITRGLEGVQVYP
HTPVTGLERRPESWRVYTSQGYQEAEAVVLAVPAGTAARLLEPLYPTAARALGEIPYGDS
ATVSLAFPAEKIPPRVGHGMLMAAGQGFHVRGFTWTDQKWAGRAPQGYALVRAYFSGISA
REAELIQMALADLERLWGQVPPPERSWVFRWPQGLPRYTVGHLERVKTATEAERLAGLFL
AGAAYQGVGLPEVVRLGSAKALQAVAFLSRGAPSAVPHPA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgagccggctggtcgtcatcggcggcggcatggccggtttatccgccgcctacgccgcc
cacaaagccaaccctgccctcaccatcaccctcctcgaggccggcccccggctgggcggc
aaggtgctgacccacgccgaggacggatttttgctggaaggtggccccgacgcggtggtg
cggtacaaaccctgggcgctggaactgatgcgggagttggggctcgagggagagctggtg
gggaccctcccggccaggccctcggccctgatccacgacgggaaacgggctttgccgatc
cctgcggggttgcagatggtggttcccggcgacctctgggcgctggcgaaaaccccgttg
ctctcccccttcggcaaggctcgagccctcctcgatctgctgttgcctggcaaggaagag
gacgaagccttcggagagtttatccggcgccgcttgggcaaccaggtgtgggagcgcttg
gcggccccgttatcgggcgggatctacggaggtgaccccgctgaactctccaccctagcg
gccttcccccagcttaaagaactcgagcgcacccatagtagcctgatccgaggtgccctt
gagcagcgaaaaaagcggggcacccgcgaagccggggggcttttcgcctcgttgcgcggg
ggattgggcacgtgggtggaggccatcaccagggggctcgagggggtgcaggtgtacccc
catacccccgtgactggcctcgagcgccgacccgagagctggcgcgtctatacctcccag
ggctaccaggaagccgaggcggtggtcttagcggtcccggccggtacggcagcacggctg
ctagaacccctttaccccacagcggcgcgggccttgggagagatcccctacggcgactcg
gctacagtctcgctagccttccccgccgagaagatacccccccgggtgggccacgggatg
ctgatggcggcagggcagggcttccatgtgcggggctttacctggaccgaccagaagtgg
gctggtcgggcccctcagggctacgcgttggtgcgggcctatttctccgggattagcgcc
cgcgaagccgagctaatccagatggccctggccgatctggagcggctgtggggccaagtc
ccccctcctgagcgcagttgggttttccgctggccccaaggcctcccgcgctacacggtg
gggcatttggaacgggtgaagacggccacggaagccgagcggttagcggggttgttcctg
gccggggctgcctaccagggcgtaggcttgcccgaggtggtgcgcctgggcagcgccaaa
gccctccaggcggtggccttcctgagccgcggagcccctagcgcagtacctcacccggct
tga

DBGET integrated database retrieval system