KEGG   Meiothermus silvanus: Mesil_3113Help
Entry
Mesil_3113        CDS       T01246                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
msv  Meiothermus silvanus
Pathway
msv00010  Glycolysis / Gluconeogenesis
msv00020  Citrate cycle (TCA cycle)
msv00620  Pyruvate metabolism
msv01100  Metabolic pathways
msv01110  Biosynthesis of secondary metabolites
msv01120  Microbial metabolism in diverse environments
msv01130  Biosynthesis of antibiotics
msv01200  Carbon metabolism
Module
msv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesil_3113
   00020 Citrate cycle (TCA cycle)
    Mesil_3113
   00620 Pyruvate metabolism
    Mesil_3113
Enzymes [BR:msv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mesil_3113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H Peptidase_M23 NQRA
Motif
Other DBs
NCBI-ProteinID: ADH64945
UniProt: D7BE87
Position
3163274..3164560
Genome map
AA seq 428 aa AA seqDB search
MATELKLPELGDNVASAVVVGVLVKEGDTLEAGQPFLELETDKAVMEVPAPAGGKVEKLM
VKPGDEVKSGQVVGMLGDGTSAAASVPAKSEASPPPSPEEPKPQTPAPQPTPAPAPVKPP
ALSAGTHKLIPAAPSVRRLARELGVDLLQVVGSGPAYRISESDVRRYADGGAAPVAPAGL
PAAAPTLPEFSKFGPTRREAMSGVRRATVRSMAQAWSLIPMVTHFDKADVTEIEALRKKY
GPRAEKRGGKLTMTAILLKVVAAALRQFPKFNASIDTASNEIVFKDYVHIGVAVDTPNGL
LVPVIRDVDKKGVITLAVELGEIAAKARDRKLTPEEMQGASFTISNLGGIGGTGFTPIVN
WPEVAIMGVSRSEMQPVWNAEKGAFEPRLIMPFSLTYDHRLIDGADAARFCRFVAEMLED
PFLLGFEG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaacttaaactgcctgaactgggcgacaacgtagcctccgctgtggtggtg
ggggtgctggtgaaggaaggcgataccctcgaggccggacaacctttcctcgagctcgag
acggacaaagccgtgatggaagtgcctgcgcccgcaggcggcaaagtggaaaaactgatg
gtcaaacccggcgacgaggtcaagagcgggcaggtggtaggaatgctgggtgacggcacc
tccgccgcggcctctgtacctgccaagagcgaagcttccccacccccctcgcccgaggaa
cccaagccccagaccccagccccgcaacccacacctgccccggcccccgttaaacccccg
gccctatccgccgggacgcacaagctgatcccggcggccccctcggtacgcaggctggcg
cgggaactgggggtggatttgctccaggtcgtcggttcaggcccagcctaccgtatctct
gagagcgatgtacgccgctatgccgatggcggcgcggctcccgtggctccggcgggtcta
cccgccgccgcccccaccctacccgagttcagcaagttcggccccacccgccgtgaggcc
atgtcgggggtgaggcgggccacggtgcgctcgatggcccaggcctggagcctcatcccc
atggtcacgcacttcgataaggccgacgtgaccgagatcgaagccctgcgcaagaagtac
gggcccagggccgagaagcggggcggcaagctcaccatgaccgccatcttgctcaaggtc
gtagcggcagccctgcgccagttccctaaattcaacgcctccatcgataccgcctccaat
gagatcgtcttcaaggattacgtccacatcggcgtcgccgtggacacccccaacggcctg
ctggtcccggtgatccgcgacgtggacaaaaagggggtgatcaccctggcggttgagctg
ggcgagatcgctgccaaggcccgcgaccgcaagctcacccccgaggagatgcaaggcgcc
tctttcaccatctccaacctaggcggcatcggcggaaccggcttcacgcccatcgtcaac
tggccggaagtcgccatcatgggggtttcgcgctcggagatgcagccggtctggaacgcc
gaaaaaggcgcgttcgagccccggctcatcatgcccttcagcctcacctacgaccaccgc
ctcatcgacggggccgacgcagcccgcttttgccgcttcgtggcggagatgctggaagac
ccattcctgctggggtttgaggggtag

DBGET integrated database retrieval system